Conserved Protein Domain Family
Phage_holin_3_5

?
pfam16085: Phage_holin_3_5 
Bacteriophage holin Hol, superfamily III
Phage_holin_6_2 is a family of holins classified as 1.E.20 in the TC database. The hol gene (PRF9) product (117 aas) of Pseudomonas aeruginosa PAO1 exhibits a hydrophobicity profile similar to holins of P2 and phiCTX phages with two peaks of hydrophobicity that might correspond to either one or two TMSs. Hol functions in conjunction with the lytic enzyme, Lys, a glycosyl hydrolase that breaks-up the murein in the bacterial cell-wall, causing lysis of the cell and hence entry of phage particles. Several members are annotated as pyocin R2_PP when encoded on the chromosome.
Statistics
?
PSSM-Id: 318333
View PSSM: pfam16085
Aligned: 2 rows
Threshold Bit Score: 154.334
Threshold Setting Gi: 81541845
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81440813   1 MNSEQQALVEMPIWLVIFLSLVGGVSGEMWRADMAGVSGWFIFRQVLLRSGACVVCGLSTIMLLYSAGMSMWSASAIGCL 80
gi 81541845  33 MGNEPQTLTEMPLWVLILLAALGGVSGEMWRADKAGLGGWALLRRLALRSGASIVCGVAVMLLALACGAALLFAAALGSL 112
                        90       100       110
                ....*....|....*....|....*....|...
gi 81440813  81 TATAGADVAIGLYKRWVAKRLGVCDVTSRSGEP 113
gi 81541845 113 TAAAGAEIAVGLYERWAARRLGVCELPEEQSDD 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap