Conserved Protein Domain Family
DUF4817

?
pfam16087: DUF4817 
Domain of unknown function (DUF4817)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 109 and 322 amino acids in length. There are two completely conserved residues (G and R) that may be functionally important.
Statistics
?
PSSM-Id: 318335
View PSSM: pfam16087
Aligned: 14 rows
Threshold Bit Score: 67.7053
Threshold Setting Gi: 637343793
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 357631353   9 RVFIIKEYFKNSESLAAAVRKFHTKYGRNSVL-TSSTVKRLIEKFMETGSV 58
gi 307178858   9 RIKIVKTYYKNGDSPAATFRALRGDFGRFNRP-TQQTVGKIVKKFEKTGSV 58
gi 637381565   7 KVFCVLQFTKTG-SVTVVRRAFRGQFG-TNPP-TPKSIRRWYRQFEETGSL 54
gi 307178038  10 YCEMIILYGECMRNAEATARAYAENFPNRRHP-DGNVIRRLINRTRNSGVL 59
gi 637343793  11 RKFVLKWYWKT-ENVKEVQRQWRQEFP-TGPP-TRVTIARIRDKFETDGTL 58
gi 358342840   6 RIEIVKLYYSLGESATASLRGYKTKHGLIKDPfTVSTITRLIAKFESTGSV 56
gi 307176320   9 NWEILKTYFQSGESSIQTVRNFRGKFGRNEMP-STQFVDQFVKRIRQTGSL 58
gi 332025472  32 RFEILKTYFQSQCCVAETVRILKRNMGRDRAP-TEGAIRKLVRKVREKGIV 81
gi 307182294   6 QVDMILIYGECQQNSVQARILYSERYPNRILP-SRQTFKNVCDKLRQTGSL 55
gi 66772329    5 RAFVIRAYYKSNDSISTAQRLFKKQFSIYQTP-PTNVIKSWLRHFESTGSS 54
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap