Conserved Protein Domain Family
PAC1

?
pfam16094: PAC1 
Proteasome assembly chaperone 4
PAC1 is a family of eukaryotic proteasome assembly chaperone 1 proteins in eukaryotes that promotes assembly of the core 20S proteasome as part of a heterodimer with PAC2.
Statistics
?
PSSM-Id: 318342
View PSSM: pfam16094
Aligned: 13 rows
Threshold Bit Score: 396.386
Threshold Setting Gi: 260808550
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82183010     1 MATFFGEVLSVYSRA-VEEDEYEDmt----nENEEDEQIRREIEEKRSVEVCW-------LLGSQDGPLQCSDLIIGAGP 68
gi 82075115     1 MATFFGEVVVAPSRAgVDDEEETE-------ETAEDREIRRELQEKREITALWtp---gaAGSPAEEPLRCSRFIVAVGH 70
gi 6685615      2 AATFFGEVVKAPCRA-GTEDEEEEeeg--rrETPEDREVRLQLARKREVRLLRrqt-ktsLEVSLLEKYPCSKFIIAIGN 77
gi 60302738     1 MATFFGEVVVAPSRA-GV--DDEEet----eETAEDREIRRELQEKREITALWtp---gaAGSPAEEPLRCSRFIVAVGH 70
gi 573879233    1 MATFFGEVLSVYSRA-VE-EDEDEle----dESEEDVQIRREIENKREVHVHWss----eITKSTDKPFQCSDFIIGVGH 70
gi 1043430950   1 MATFFGEVQSVFSRA-VDEDDEEEeg----eEEEEDREIIAELDRKREVHVTWnpevtaaIESSPNRRLPCSSVILSVGD 75
gi 762106571    1 MATFFGEILPVISRA-VDDDDDDEs-----fENLE-----------TYVKIKWkkeaqeeMELTNDKKLQANAFVLAVGP 63
gi 260808550    5 lgcgYGDLVLASSRA-VDDEEEEEea----sQKPS-----------PSAVLRWstqakqeISESPNDCIECSALIVAIGP 68
gi 410931239    1 MATFFGEVLSVFSRA-VEEDE-DDl-----sDNEEDEQIRRELEEKRVVHLHWnpe-vteCLKS-GNKLKCSDFILAVGP 71
gi 395518495    2 AATFFGEVVKVRSRA-VTEEEEEEeeepwarDNLEDKEVRQELEKKREVEVLQtqt-kvsLEIPLLEQYPCSKFIIAIGH 79
gi 597766944    1 MATYFGEVLSVYSRA-VEEDEYDDle----dENEEDVQIRREIEEKREVQVRWcpe-vskTLES-SGQLQCSNMIIAVGP 73
gi 551520625    1 MATFFGEVLSVYSRA-VEEDD-EEl-----eENEEDEQIRRELEEKRTVHLHWnpe-iseLLRA-GNKVQCSSFILAVGH 71
gi 432901142    1 MATFFGEVLSVCSRA-VEEED-EDf-----vENEEDEEIRRELEKKREVNLLWnpe-tsqSLAS-GNKLQCSDFFLAVGH 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82183010    69 NASGFIRAYLLSTVGWTAVAWL--S--FWNERSRGSERPTvvpgPGEPSCVLYRLESCPTVLICQCQGFVAEDQLFQFTE 144
gi 82075115    71 NAVAFLSAFILDSVCWKIVGAV--K--LWNEWCQTTNATSv--lPTDSFCLFYQLISDPTVLLCQCSCYVAEDQQFQWLE 144
gi 6685615     78 NAVAFLSSFVMNSGVWEEVGCA--K--LWNEWCRTTDTTHl--sSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLE 151
gi 60302738    71 NAVAFLSAFILDSVCWKIVGAV--K--LWNEWCQTTNATSv--lPTDSFCLFYQLISDPTVLLCQCSCYVAEDQQFQWLE 144
gi 573879233   71 NAAGFLSAFVLSSGSWEAVGSA--S--LWNERSRGSSQPA-----GEPSCRFYRSAGCSSVLICLCTCFVAEDQLFQWTE 141
gi 1043430950  76 NATGFVSSYILSSGSWEVCGSI--T--LWNERCRDCNARKds-lPAPSSCTFYRSITDPTVLLCQCNSYIAEDQLFQWCE 150
gi 762106571   64 AATGFTQTYVTHK-NYEIIGAMfcG--MKEDDVNTFGQMS----PTDKTCYIYRKCDYPSALVCECNYDIRPEYAHSFVN 136
gi 260808550   69 VATGFIHTYLLHQE-TEILGMI--GsgLLEDTCNTFEQTS----PADATCFLHRLMSAPSVIVCQCNVDVPPEMMFSWTQ 141
gi 410931239   72 NAARFLSVHALTSANWDTVGHS--S--LWNERNQTTTGQT----SVEPACVFHRQKDNPSVLICQVTCYIAEDQLFQWTE 143
gi 395518495   80 NAVAFLSSFVMNSGTWEEIGCT--K--LWNEWCRTRDTANl--sPTDAFCVFYRLKSDPTIFLCQCSCYVAEDQQYQWLE 153
gi 597766944   74 SAAGFVSAYVLSAEGWTQVGWV--S--LWNERSRGSSRPDtvpqPGEPSFIIYQQNSSPSVLICQCTCYIAEDQLFQCAE 149
gi 551520625   72 NAASFLSAYILASANWDVVGRA--V--AWNEMSRSGTGPS----GEGSACVFYRHKDEPAALICHVTCHIAEDQLFQWTE 143
gi 432901142   72 NAASFLSAYVLSSSNWDAVGRA--S--VWNERSRAVAGQS----SEESACVFYRHKDIPSVLICRVTCYIAEDQLFQWTE 143
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82183010   145 KVFSCVQTRDLNVTILSDCSSADYKTSDYLSGSSTPFLRCLKTSTYTHTVTCPPLEQPNICSGLAAAVLSHCQVHQISAV 224
gi 82075115   145 KVFGHIGKEGLQVTILSTCPVAEYKTQESTLTLPSPFLKALKTKEFKEEVCCPLLEQPNIVRDLPAAVLSYCQVWQIPAV 224
gi 6685615    152 KVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAI 231
gi 60302738   145 KVFGHIGKEGLQVTILSTCPVAEYKTQESTLTLPSPFLKALKTKEFKEEVCCPLLEQPNIVRDLPAAVLSYCQVWQIPAV 224
gi 573879233  142 KVFGFIQTRGLQVLVLSDASVSEYTTADPVSASPVPFLRALKSSAYQDRVHCPMMEQPNIVTCLPAAVLSHCQVHQIPAV 221
gi 1043430950 151 KVFGSLEKSGLNVTVLSTCPVSEYKTPESTYSLPVPFLKALRTSEYREEVPCPLLEQPNIADGLPAAVLTYCQVWQIPAV 230
gi 762106571  137 QLMSCLNLCEGHVVIFGSTFTSEYKSDVPTSDMNPPFMRALKTASFLGTPMAPYLEQPNVATGLPAQMLTYCHIHKLNAV 216
gi 260808550  142 QLFSCINIHNTYVGVLASAPVSEFRSSVSLSDVTVPFLRGLKTNQFHGKPVCPYLEQPNTAKGLPASVLTHCQVYRVPAV 221
gi 410931239  144 KVFDCLQHRQLNVTVLSDSSVAEYKAADYLHCSSAPFLRSLHSSTYNGKSVCPSLEQPNIFTGLPAAVLSHCEVHRIPAV 223
gi 395518495  154 KVFGSSPNRNLQITILTSRHVTDYKTPESSCNLPSPFLKALKTQTFQDAACCTLLEQPNIVHDLPAAVLSYCQVWRIPAI 233
gi 597766944  150 KVLSSVQRRGLNVTVLSDSTLAEYKTPDYLNGSGTPFLRALKTSSYTGSMLCPLLEQPNIVTGLPAAVLSHCQVQRIPAV 229
gi 551520625  144 KVFGYLQTRGLTVTVLSDSSVADYKTADYLCSSSAPFLRSLCSSAFSDQPVCQSLEQPNIITGLPAAVLNHCQVHSIAAA 223
gi 432901142  144 KVFDCVQHRGLNVTVLSDSSVADYKTENYLSSSSAPFLRSLHTAAFSDQPVCQSLEQPNIVTGLPAAVLNHCQVHCIAAV 223
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 82183010   225 LYQCYSDVLHPDSASMQMFAATLSSVL----KLEQSLSADVLQRVTRVSEIQSNLY 276
gi 82075115   225 LYQCYTDIIKLDAVTIEAFKPLLSSKPlknlVKDISESTKILKKLLTTGETHNNIY 280
gi 6685615    232 LYLCYTDVMKLDLITVEAFKPILSTRSlkglVKNIPQSTEILKKLMTTNEIQSNIY 287
gi 60302738   225 LYQCYTDIIKLDAVTIEAFKPLLSSKPlknlVKDISESTKILKKLLTTGETHNNIY 280
gi 573879233  222 LYQCYSDVVSPDTVTMETYKPALPCLSkl-vTLDSSPSIDVLRKVVKSSESQSNLY 276
gi 1043430950 231 FYRCYTDLSKLDSITIDAFRPLLSCQRmsrlAADSAKIQETLRKTVKSSEIQSNLY 286
gi 762106571  217 LYMCYTDSIHLDFATLKTFQPLIESTPvkymREENKKASETLKKIVDLHTKHSTLY 272
gi 260808550  222 LYMCYSDSIYVEIPAIKAFLPVLKGTPfrdiVQENPHADISLRKLVELRALQNNLY 277
gi 410931239  224 VYQCYSDVLGADSVTMETYNPVLTSLGks-iQLDPAPSTDVLRKFSRTSNIQSNLY 278
gi 395518495  234 LYLCYTDVMKLDLVTVEAFKPILGSESlkglVKNVSHGTEILKKLVTRNEIQSNIY 289
gi 597766944  230 LFQCYTDVLHPDSVTMETYKPALSCLSts-vKLEACPSVEVLQKLTRISDAQSNLY 284
gi 551520625  224 VYQCYSDVTGPDSITMDKYKPVLTKLGrs-iqVYSSQSTDVLCKFVRSSEIQSNLY 278
gi 432901142  224 VYQCYSDVIGPDSVTMETYMPVLTKLGkv-mQLDQPPTTDVFRKFVRTTDIQSNLY 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap