Conserved Protein Domain Family
PRIMA1

?
pfam16101: PRIMA1 
Proline-rich membrane anchor 1
Statistics
?
PSSM-Id: 318349
View PSSM: pfam16101
Aligned: 8 rows
Threshold Bit Score: 155.009
Threshold Setting Gi: 351698829
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 338819227  37 PQKSCSKV-----TDSCQHICQCRPPPPLPPPPPPPPPPRL-LSAPAPNSTSCPAEdSWWSG--LVIIVAVVCASLVFLT 108
gi 292624759  37 LQKSCSRTtvaplEGSCQLPCQCRPYPPLPPPPPPPPPPRL-LAPTVAPSTVSPMT-PWRREmeILVLGTVICASVVFLL 114
gi 351698829  37 PQKSCSTV-----TDSXNQKGQ---RPPFPAPAQPPPAPELfLSLPAPNSTSCPAEeSWWSG--LVIVIAVCCASLVFLT 106
gi 395503700  37 LQKSCSKTitekgTDSCQEICQCRRPPPLPPPPPPPPPPRL-LSLTPPNSTSCPAEePWWSG--LVIIIAVCCATLVFLV 113
gi 733890355   9 PQKSCSKPvaddvPESCQQICQCRPPPPPPPPPPPPPPPRL-LVVPAPKSTFCPTEeTWWPG--LVIIIAVCCATLVFLF 85
gi 573889686  37 LQKSCSRTiaekaSESCQLTCQCRPYPPLPPPPPPPPPPRL-LVSQTPEPSVPQMK-PWWKE--IVIIGTVGCATVLFLL 112
gi 941785207  98 iQRSCSWTvaekvGEQCQVACHCRRYPPLPPPPPPPPPPRL-LGTTVAQPMVPLLR-PWWTEvdVIVLGTVSCASVVFLL 175
gi 597788025  35 LQRSCSQLgtqrgGEQCQSPCHCRTYPPLPPPPPPPPPPRL-LIPTVAEPPSVPLR-PWWTD--FIVVGTVGCTSAVFLL 110
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 338819227 109 VLVIICYKAIKRKPLRKDENGASVAEYPMSSSPSNKG--VDVNAAVV 153
gi 292624759 115 LTAIICYKAIKRKPLRKEENGTSRGEYAMSSRCKQQV--VETNNTGV 159
gi 351698829 107 VLVIICYKAIKRKPLRKDENGTSVAEYPMSSSQSTKG--VDVSNAMV 151
gi 395503700 114 VIVIICYKAIKRKPLRKEENGTSGTEYAMTSSQNNKT--VDVNNAVV 158
gi 733890355  86 VVVIICYKAIKRKPMRKEENGTSRAEYAMTSSQNNKT--VD-NNAVV 129
gi 573889686 113 LMVIICYKAIKRKPLRKEENGTSRGEYAMSSR-NNKA--LDANNAVV 156
gi 941785207 176 SAIIICYKAIKRKPLRKEENGTSRGEYAMSIR-NKKA--MGTNNTVV 219
gi 597788025 111 LTLIICYKAIKRKPLRKEENGTNRGEYAMSSRKKKKTknAGTNNVVV 157
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap