Conserved Protein Domain Family
DUF4867

?
pfam16161: DUF4867 
Domain of unknown function (DUF4867)
This family consists of uncharacterized proteins around 220 residues in length and is mainly found in various human gut Firmicutes and a few eubacteria species. It is also amply represented in human gut metagenomic datasets. Distant homology analysis and marginal HMM overlaps suggest this family is a distant homolog of Ureidoglycolate hydrolase pfam04115, but this prediction is not verified by experiment, therefore the function of this family is still unknown.
Statistics
?
PSSM-Id: 318406
View PSSM: pfam16161
Aligned: 70 rows
Threshold Bit Score: 232.424
Threshold Setting Gi: 489631564
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122264346  18 SLDETAFADYGVTYAQ-YDVS-----ELKNFMdQHVtiPAP-SeANLYVPSNPDMEKIPVVQQIGRDVYAGLPIEAGECA 90
gi 503474285  16 SVSDPTFRDYGQVLAD-IDMA-----APLKALaKK---PLPaE-GNIYVASDNELESTDAALWLRYEIFGGMPVEVGYCN 85
gi 504037129  23 TLDSSRFRKYGRILKG-MDVS-----ELVETAdNLT--AIP-EeGNIYEPGLKGLEDCTVSRQFG-TYFGNMPIQVGYCN 92
gi 506359325  18 SVLDDKFKCYGSVLDG-DDFA-----DLVKFSlENI--QTP-SsGNLYTPNFPDLYKFKAIQDIKSKVYGELSIQAGYVT 88
gi 503735409  17 taeDDHFAPFGRTFKH-PHMG-----AILEQAnPLV--PDGlE-ENQYVASVPELEALP-GKELYDQIFGAISIQVGFVV 86
gi 504267141  22 aVHHADFAPYGRVLGG-LSAA-----EALASAqQMI--TFP-EqGVQYLRSVAELERLPLRGELESQVFGGMPIQLGWCI 92
gi 503373278  23 rIDSSRFSQYGTLLPS-LCVQ-----ELIASQeKLT--TIPkE-GNIYVASLAELEALPETRNME-TYFAGQPIQVGYCN 92
gi 489631564  17 SITDEAFRTYGKVIDNnIDEAiefciDFVQAAkQ----------DNFYLPSVLEVEQLSSIIELSHRVYGYLEIIAGIVA 86
gi 524488638  18 SVLDPEFASYGRVVTG-YDFS-----EMIAYMeQNT--PIP-EnGNTYVASVPEMEALAVSAEVQKKFYGDMPIEVGYCN 88
gi 502255993  15 SVTDPCFETYGRVISN-INCN-----ELISFMeQNT--VIP-EkGNIYVASVEELERTHIAEFFKNRIYGEMPIQIGYCN 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122264346  91 GHAEALTAVEFHQGSEVNVFFTDVVMVIGKRGQMH-DD-QFNAEKdAKLFFVPAGTVVEFFSDTLHYSPCEAHASGFKFI 168
gi 503474285  86 GHSSQLNCLEWHNAPEVNIATDDIVLFLGRTPELQ-GD-RYRVED-IKAFFVPRGTCISIFGTTMHFAPCRTSEDGFRCL 162
gi 504037129  93 GTNQTINGMEYHKSPELFVAVTDCVQFLCSFENLN-EFnTVRTQD-AEVFFFPKGSVSLIYANVMHLAPCTVRGKGFKSI 170
gi 506359325  89 GHNHSLTGFEYHQGSETIVAITNLVLILGKKQDLV-DD-IYLSEK-ADVFFVNAGQAVELYSTTLHYTPCKTSQDPFLAI 165
gi 503735409  87 GPNMSLNGLEYHKSPEVLIALTDQVLLLGKWEDIDpDW-QYDSSQ-VIGLYLKKGDAIELYPRTLHFSPCRVQDGGFKSL 164
gi 504267141  93 GTNQVLNALEFHKSSEVIIAGSPVVLVLGHRHDIR-DN-RYALEQ-AACFYLPAGTAVELYAECLHFAPIGAAAGPFLTL 169
gi 503373278  93 GRNTSINGAEYHKSPELFIAVTDCLQFLTPFSQLK-DFsSVHTNS-AELFYFPKGSVALIKERVLHLAPLCVHKEGFKSI 170
gi 489631564  87 GDNVELSGIEYHQGSETIIAVTDYILVVGHIWDMQ-DD-TYNSSK-CELFYVPKGTIVECYSATLHYTPIAVSKEGFITI 163
gi 524488638  89 GRNTTWNGFEYHKGSEINVAVTDFMLILGHVWQIE-DN-TYRFEN-AKVFFVPKGTAVEMYQTTLHLSPCRVCDAGFKGV 165
gi 502255993  86 GRNTTYNGFEYHKGSEINIAVTDFMLVLGHTWEIK-DN-TYRIED-AKVFFVEKGTAIEMYQTTLHLSPCRVSDIGFKDV 162
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122264346 169 VMLVRGSNQPLpad-------------yhtDN----KLIVKQNKFQVVHA-SR-TdKIKQGIQVGVTGEL 219
gi 503474285 163 VMLLADVNTDLpeh-------------pyaEDrarpRTLFKYGKWLIAHP-DN-ErFVACGAYPGIVGEN 217
gi 504037129 171 IVLPLHTNEPLdeegkel-----lktcpdpEG----RLLFKKNKWMIAHP-ERqQ-LVSQGVHIGLVGEN 229
gi 506359325 166 VVLPDGTNSLLne---------------ndKQ----KTLIKKNKWFIAHAsEK-D-KIKNGAFPGLLGgv 214
gi 503735409 165 IILPRGTNTPLsetile-------qrtpgtEA----QCLFMKNKWLLAHP-ER-KpLMQKGAYPGIRGKN 221
gi 504267141 170 IALPAGTNAPLegqstpplpagdqgagasdEQ----QLLWQCNKWLLAQP-GS-P-QAEQGAHVGLTGsq 232
gi 503373278 171 IVLPKGTNEPLdkelqk--------dpsceED----RLLFKQNKWMLAHP-ARvQ-LTSQGVVVGLEGEN 226
gi 489631564 164 CLLLKGTGDILekr-------------kkiLK----KKNK----WFIAHQ-DNlE-KIASGDYPGLLGrk 210
gi 524488638 166 VILPRGTNTPLdektp----------ngdpES----KLLLQRNKWVIAHP-ER-EpLIKQGAYPGLLGEN 219
gi 502255993 163 VILPRGTNTPLnnggtd--------etaigEE----RLLLQRNKWVIAHP-DR-EpLIKQGAYPGLLGEN 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap