4ERN


Conserved Protein Domain Family
ERCC3_RAD25_C

?
pfam16203: ERCC3_RAD25_C 
Click on image for an interactive view with Cn3D
ERCC3/RAD25/XPB C-terminal helicase
This is the C-terminal helicase domain of ERCC3, RAD25 and XPB helicases.
Statistics
?
PSSM-Id: 318443
View PSSM: pfam16203
Aligned: 40 rows
Threshold Bit Score: 364.247
Threshold Setting Gi: 855314558
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ERN_A         3 LQNNGYIAKVQCAEVWCPMSPEFYREYVA--I-K--TK-KRILLYTMNPNKFRACQFLIKFHE-RRN----------DKI 65
gi 74955815  499 LQKAGFLANVSCSEVWCPMTAEFYKEYLI--N-D--SQgKKKLLYTMNPNKFRACEYLIRFHE-QRG----------DKI 562
gi 122160375 492 LQRDGHIANVQCVEVWCPMTAEFFRKYCD--S-Ny-SN-KKQVLYCMNPNKFMACQFLMQFHEqQRK----------DKV 556
gi 291000979 430 LQQKGHLANVQCVEVWCPMTAEFFAEYLT--A-N--AK-KKTLLYVMNPNKFRACEFLIRYHE-KQG----------DKI 492
gi 255071253 514 LQRDGHIANVQCVEVWCPMTAEFYKKYLS--N-Dl-AA-KRQILYCMNPNKFMTCQYLMQFHEkQRK----------DKI 578
gi 290983477 530 LQKKGHLANVQCVEVWCPMTAEFYAEYLS--S-N--YA-KQSLYYVMNPNKFRACEFLIRYHE-KHG----------DKI 592
gi 299115227 590 LTQSGYLANVQCVEAWCPMTAEFYSEYLKpgV-T--AR-QKQLLYIMNPNKFRTCEYLVRTHM-ERN----------DKV 654
gi 514696388 513 LQEAGYIARVKCFEVWCPMVQSFYEQYWR--T-D--SHaQKMKLCVCNPNKFSACEFLIRKHE-ARG----------DKI 576
gi 855314558 460 LTNKGYLSPVRCLEVWCDMNPLFYNEFLR--R-SkeYN-KQKLLAVVNPEKLKALAYLLYIHV-QRGfsspllfsssDKI 534
gi 219119406 418 LTAQGYLANVQCVEVWCPMTGPFMKEYLM--AsN--SR-LKQLLYVMNPSKLRAVDFLVRFHE-ARG----------DKI 481
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ERN_A        66 IVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQ 145
gi 74955815  563 IVFSDNVYALQKYAKGLGRYFIYGPTSGHERMSILSKFQHDPTVRTIFISKVGDTSIDIPEATVIIQVSSHYGSRRQEAQ 642
gi 122160375 557 IVFSDNIFALREYATALRRPLIYGDTSHAERTRVLHAFKYSNEINTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQ 636
gi 291000979 493 IVFSDNVFALQEYAEKLGVPYIFGNTKQQERVYYLNQFRNTNHYNTIFISKVGDTAIDIPEATVIIQISSHFGSRRQEAQ 572
gi 255071253 579 IIFSDNIFALREYATVLRRPLIYGETSHAERTRVLHAFKFSDEVNTIFLSKVGDNSIDIPEANVIIQISSHGGSRRQEAQ 658
gi 290983477 593 IVFSDNTFTLEQYAIKLKLPYIYGKTRESERLDVLNRFK-SGNFNTVFLSKVGDTAIDIPEATVIIQISSHFGSRRQEAQ 671
gi 299115227 655 IIFGDNVFSLKKFATILQIPFIYGATPESERSRILGTFRVNPLVNCIGLSKVGDTSIDIPEANVIIQISSHFGSRRQEAQ 734
gi 514696388 577 IVFSDDIFALHELATKLNKEYISGDTPDRQRHEILDRYKKRDDFRTIFFSKIADNAFDLPEANVLIQVSSQGGARRQEAQ 656
gi 855314558 535 LVFCDSIFPLHKFGELFGYRYLDGSCGEPYRKRVLNDFRNSSAGSVVFLSKIGDTSIDLPEATVLIQVEGQEGSRRQEAQ 614
gi 219119406 482 IVFSDLVYSLKLYAEMLKKPLIYGETPERERQAILGTFRASDAVRTICISKVGDTSIDLPEANVIIQVSSHFGSRRQEAQ 561
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ERN_A       146 RLGRVLRAKK------GMVA----------EEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGM---E-- 204
gi 74955815  643 RLGRILRPKP------K-SD----------GLYNAFFYSLVSKDTQEMYYSTKRQQFLIDQGYSFKVISELPGI---D-- 700
gi 122160375 637 RLGRILRPKAaqlsgkKTNA----------DEHNAFFYSLVSTDTAEMYYSTKRQQFLIQQGYAFKVVTDLIGP---Q-- 701
gi 291000979 573 RLGRILRPKG------GGL-----------KNQQAYFYTLVSQDTQEMFFSTKRQQFLINQGYSFRVLPDIQKY---Yrq 632
gi 255071253 659 RLGRILRPKR------IAAQasilegaagvGEHNAFFYSLVSTDTEEMYFSTKRQQFLVQQGYAFKVVANIFDE---S-- 727
gi 290983477 672 RLGRILRPKN------GTN-------------KQAYFYSLVSQDTKEMFFATKRQQFLTNQGYSFRVLADIQKYyssN-- 730
gi 299115227 735 RLGRILRPKS------N-VD----------GGFNAFFYTLVSTDTSEMYYSSKRQQYLVDQGYTFKVVTDLANA---S-- 792
gi 514696388 657 RLGRILRAKS------NTKTr--------pGEPNAFFYSLVSRDTKEMAYATARQRFLVDQGYAFQVLTRLVGF---E-- 717
gi 855314558 615 RLGRILRPKM------G-LS----------MGNQAFFYTLVSRDTKEVGNALNRQRYLMAQGYTYKVLVNITKG---L-- 672
gi 219119406 562 RLGRILRPKSytq-qdGSNR----------STFNAFFYTLVSSDTQEMFYSAKRQQYLIDQGYTFKIVTNLCEK---A-- 625
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ERN_A       205 --E----E----DL---AFSTKEEQ-------QQLLQKVLAAT-----DLDAEEEV--VAGE------F-------GSR- 243
gi 74955815  701 --Qe---V----NL---KYSSKQDQ-------LDLLAQVLGEG-----EDSGKNEI--LEED------FdditrgaK--- 745
gi 122160375 702 --Dk---Q----QL---MYSTQEKQ-------LDLLAKVLSAG-----EAEAGEEV--LPDDedairkA-------QKP- 747
gi 291000979 633 gaNe---M----GLtlkHMNTKKEE-------LDMLAIVKKAE-----DARGQEEK--INVD------D-------Evek 678
gi 255071253 728 --Ve---H----QL---LFHTREDQ-------MALLERVLRLD-----EVAAVDEA--LVEdddditridivsdtvkrre 781
gi 290983477 731 --Rv---E----TK---FMKTKEDE-------LEFLKLVKNAK-----DVNGKLED--IPND------D-------FQS- 770
gi 299115227 793 --Dr---S----QS---KLPDRKSE-------LRVLQETLMAKt----DQEEKDEKkmLDRD------M-------DDI- 835
gi 514696388 718 --EeakvT----PF---VFDSPAEQ-------KQLLIKIAESS-----SMIEEarnaanaakkakragksvvqrasmdaf 776
gi 855314558 673 --Tr---E----MI---QRIPKMQQicsgdfaKNLLQESLEAK-----AEEMQRHE--RSKM------L-------EEV- 719
gi 219119406 626 --Da---EaianGC---TFATPEDD-------RKLLRTVLTSEtdlekEQRAEDTA--IRKN------N-------TDGa 675
                        330
                 ....*....|..
4ERN_A       244 --SS-----QAS 248
gi 74955815  746 --KSkssapTVS 755
gi 122160375 748 --AG-----AAR 752
gi 291000979 679 sssslasisggn 690
gi 255071253 782 esilalsgaqgt 793
gi 290983477 771 --GShsgdtsla 780
gi 299115227 836 --Gegsargtvm 845
gi 514696388 777 agagdmvyeerr 788
gi 855314558 720 --NS-----KVQ 724
gi 219119406 676 alAD-----AAS 682
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap