Conserved Protein Domain Family
Keratin_2_tail

?
pfam16210: Keratin_2_tail 
Keratin type II cytoskeletal 1 tail
Statistics
?
PSSM-Id: 318450
View PSSM: pfam16210
Aligned: 7 rows
Threshold Bit Score: 49.5579
Threshold Setting Gi: 238054406
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238054406 493 MSGECAPNVSVSVSTSHTTISGGGSRGGGGggy-gsGGSSYGsGGG-SYGSGGGGgggrgsyGSGGSSYGSGG---GSYG 567
gi 126302559 501 MSGECTPNVSVSVSTSHTSMSGSSSRGGGS------GGGRYG-GGG-SYGGGSGG-------GSYGGSSGGGGs-gGSYG 564
gi 350583977 499 MSGECAPNVSVSVSTSHTSISGGSIRGGGGs-----GGGSYIsGGGsSYSSGGGG-------GSGSYSSRGGG---GSYS 563
gi 513023021 491 MSGECSPNVSVSVSTSHTSISGGSVRGGGG----------YSsGGG-SYSSGGGG---------GSGGYSSGG---VSYG 547
gi 410964495 499 MSGECSPNVSVSVNTSHTTISGGGGRGGGGfg--sgGGG----GGG-GYGSGGGY-------GSGGGSYGSGG---GGYS 561
gi 395835411 503 MSGECPPNVSVSVSTSHTSISGGGGRGGGGygsgggGSGSYGsGGG-SYGSGGGG-------GSGSGSYGSGGggrGSYG 574
gi 586479319 457 edmarllrdyqdlmntklaldmeiatyrtllegeeirmsgecvpnvsvsvstshtsvsgggsrggggsygsgggsygsgg 536
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 238054406 568 SGGGGGGhgsYGSGSSSGGYRGGSGGGGGGSSGgrgsggGSSGGSI---GGRGSSSGGVKSSgGSSSVKFVSTTYS 640
gi 126302559 565 GGSGGGSyggGSGGGSSGSHRGGSGGGGGSSGGsy---gGSSGGGR---GGSSSGGGGVKSS-GSSTVKFVSTSYS 633
gi 350583977 564 SGGGGGG------GGSSGGY-GSRGSSGGHRGG--------SGSSFtssGGRGSSSGGTKTSgGSSSIKFVSTSYS 624
gi 513023021 548 SGGGGGS---YSTGGSSGGRRGGSGGGGGSSGGr-----GSSGGSFgssGGRGSSSGGQKTSsGSSSIKFVSTTYS 615
gi 410964495 562 SGGGGG----FGSGSSSGGHRGGSGGGGRGSGG-------SSGGSFsssGGRGSSSGGTKTSgGSSSVKFVSSSYS 626
gi 395835411 575 -GSGGGSy-gGSGGGSSGGHRGGSGGGGSSSGGrg--sgGSSSGGRgsgGGSSGGSGGVKSSgGSSSVKFISTSYS 646
gi 586479319 537 ggggggggsygsggssgghrggsgggggggssggrgsaggssggsygssggrgssSGGVKTSgGSSSVKFVSTSYS 612
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap