Conserved Protein Domain Family
DUF4891

?
pfam16232: DUF4891 
Domain of unknown function (DUF4891)
This family consists of uncharacterized proteins around 140 residues in length and is mainly found in various Bacteroides species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318468
View PSSM: pfam16232
Aligned: 13 rows
Threshold Bit Score: 118.993
Threshold Setting Gi: 81314732
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81314983   37 EADSLPRATAIFWLDKYHmk-eLKKDDVLTFRTAKAKVVIRNDGTIDLLSFVEQQPGNAQRYIRYRLKDFKVKKILMDNG 115
gi 81445166   41 CMVDTVKATAIFWIDKAE----AKHCKDSGLRTIKAKVFIHENGKVDFLSFTKKQSSGVEKYILHHLDKFQISKRMLEGG 116
gi 81314732   40 KKNNIGKATYIFWINKTE----AKKLRGLTF-NIKCKVTINEDGSIKILGYEKEQPYTVTKSLKKYLKTFRVDKEALADG 114
gi 496037042  41 CMVDTVKATAIFWIDKAE----AKHCKDSGLRTIKAKVFIHENGKVDFLSFTKKQSSGVEKYILHHLDKFQISKRMLEGG 116
gi 494936497  36 FVDTTPKATAIFWIDKHKempgQPSKRPGAVRTVKAKVNIHLAGRIEVLSYVKPQKGYIKSYINRRLETFRVRKVLMDSA 115
gi 495419269  43 VEDSVPKATAIAWVDCDR------NRSFSSARTVKVKAYIHHSGKISVLEYVKKPPLRVQSYLRKRLEVYRVPKALLEGG 116
gi 503313207  36 LMDTTPKATAIFWIDKSKd--pLKKEFPIPIRSVKTKVDIDSTGKVEILSYVKPQDGKVRKYIQHRMKMFRVSKIMLDSG 113
gi 492414488  34 PVDTTPKATAIFWVDKDKdyqaKKKDGPLSLRTVKARVEIDSLGKVNLLAYTKPQSQRIKSYLQYRLEVFRVKKVMLDSG 113
gi 524822853  36 ggcegEKAKAILWVDYKKg---RSIPAGVAIRTVKVRANVFADGSVKVLSFCKKQSFRVEDYLLKRLKAYRIRDWAFEGN 112
gi 495420375  38 VAESVPKATMILWIDYDRr---GTSAQGKSLLNVKAKVNIQPDGSVQVLEYVDEPSVVVESYIRKTLRRYRVKQKFLEEE 114
gi 524821950  44 qdgkLPKASVIFWIDLDK----SKSNSGKTIRNVKAKVSINKEGKIKVLEYNKKQPLLITNKIDKCLKTFRVKPEWIASG 119
gi 492725411  36 ggcegEKAKAILWVDYKKg---RSIPAGVAIRTVKVRANVFADGSVKVLSFCKKQSFRVEDYLLKRLKVYRIRDWAFEGN 112
gi 490441904  41 CTADTVKATAIFWIDKAE----TKHCKEYGFRTIKAHVLIREDGKVDLMSFVKKQSPAVETYIRHHLSKFKVSEKMFEGG 116
                         90
                 ....*....|....*
gi 81314983  116 YINPGEQYVQLRYIP 130
gi 81445166  117 YIQTGEQFVQLRCMR 131
gi 81314732  115 RVKVGDQVVFLRYVV 129
gi 496037042 117 YIQTGEQFVQLRCMR 131
gi 494936497 116 YIKPGVQYVQLRYTP 130
gi 495419269 117 YIQPGEQYLQLRYIP 131
gi 503313207 114 FVKAGEQYVQLRYMP 128
gi 492414488 114 FVKPGVQYVQLRYLP 128
gi 524822853 113 YIQTGEQYLQLRYIP 127
gi 495420375 115 SVRPGVQYVYLRILK 129
gi 524821950 120 RVKVGENIVFLRFLD 134
gi 492725411 113 YIQTGEQYLQLRYIP 127
gi 490441904 117 YVQPGEQFVQLRCLw 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap