Conserved Protein Domain Family
DUF4892

?
pfam16234: DUF4892 
Domain of unknown function (DUF4892)
This family consists of uncharacterized proteins around 270 residues in length and is mainly found in various Pseudomonas aeruginosa species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318470
View PSSM: pfam16234
Aligned: 7 rows
Threshold Bit Score: 305.957
Threshold Setting Gi: 848256509
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81541315   20 DLPGSHDLDILPRFPRAEIVDFRQAPSEERIYPLGAISRISGRLRMEGEVRAEGELTALTYRLPPEHSSQEAFAAARTAL 99
gi 123656987  20 DLPGSHDLPLVPRLADAQIVDYRPEVEQERVYPLGSIRRISGQLRFDGQVNARGKLTAITYQLPAERTSNEAFTLAREAL 99
gi 512734282  21 DLPDSHDLAALPRFPHAEITDFRETPDQERVYPQSSIRRISNQLRMERKVEAEGRQTSITYRLPEGHSSFDAFDRARRDL 100
gi 848256509  16 DVAGSADLERVPRFAQAQIIDYRQSTVQERIYPQDSIRRISGNLRMAAQVVASGRLTAVTYQLPASHTGIEAFTQARGDL 95
gi 489333529  20 DVPGSRDLEVLPRFPASHIVAFREAPDIERIYPQGSIRRISGRLRYEREILVQGRHSAVTYELPRTHSADQVFNASREAL 99
gi 503557594  19 DVAGSRDLDVLPRFAGSEIVTFKEEAEQERVYPQGTVRRISGRLRYEREVLVQGALTAVTYELPGTHSANEVFTQAREAL 98
gi 502029292  20 DLPDGHDHEVLPRFPQAEIVESSQG-DAERRYPLGGIQRISGRLRYEREVLAEGWLSATTYRLPVGHLAAEAFAQARESL 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81541315  100 LKADATPLFWCERRDCGSSSLLANAVFGNAKLYGPDEQQAYLLVRLAAPQ---ENSLVAVYSITRGNRRAYLQAEELKAD 176
gi 123656987 100 QKQGAELLFWCQARDCGESSLWANEVFGNAKLFGADEQQAYLLLRLAAPQ---DNSLVALYSITRGNRRAYLHVEQFDAS 176
gi 512734282 101 LERGAELLYWCQGRDCGSSSLWANTVFGNAKLYGPDDQQAYLLVRLAEPS---QDSLLAIYSITRGNRRAYLHAEQLDAN 177
gi 848256509  96 LEQGAELLFWCEGRECGSSSLWANAIFGKSMLYGPEAQQAYLLARLPEGEtegQDDLIALYGVTRGNGRPYLHVEQLQPD 175
gi 489333529 100 LEQGAELLYWCQGRECGASNLWANAVFGNATLYGSDDQQAYALLRLAEPN---HESLLALYSITRGNRRAYLHVEQLDAG 176
gi 503557594  99 QDQDAQLLYWCQGRECGSSSLWANSVFGNSTLYGSDDQQAYALLRLAEPR---HDSLVALYSITRGNRRAYLHAELLKAD 175
gi 502029292  99 LRQGAELLYWCDGRDCGSSSLWANTVFGNARLYGPDERQAFALLRLAAPR---RDSLLALYAITRGNRRDYLHVERLDAA 175
                        170       180
                 ....*....|....*....|....*
gi 81541315  177 APLAELLPSPATLLRLLKANGELTL 201
gi 123656987 177 APLGDLLPTSATLLRQLKDTGKLDL 201
gi 512734282 178 APLGELLPTPDTLMRELKSSGELHL 202
gi 848256509 176 EPLAQVLPTAATLLRQLRSTGELRL 200
gi 489333529 177 APLGELLPTPATLLRQLRTDGQLQL 201
gi 503557594 176 QPLAKVLPTPATLSRQLKSTGSLRL 200
gi 502029292 176 AALGELLPTPATLLRQLRTDGQLLL 200
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap