Conserved Protein Domain Family
Sm_like

?
pfam16243: Sm_like 
Sm_like domain
This domain, approximately 150 residues, is mainly found in several uncharacterized proteins in various Prochlorococcus and Synechococcus species. The crystal structure of ECX21941 reveals unexpected similarity to Sm/LSm proteins, which are important RNA-binding proteins, despite no detectable sequence similarity. The specific function of this family is unknown, but the structure analysis of ECX21941 indicates nucleic acid-binding capabilities and suggests a role in RNA and/or DNA processing.
Statistics
?
PSSM-Id: 318477
View PSSM: pfam16243
Aligned: 10 rows
Threshold Bit Score: 130.209
Threshold Setting Gi: 418487283
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122147513  14 IFKLNNGEEVVGKAVLTDDQGETLVFISNPVVIETYTRELDSGKISRGMGFSHWMQMSDEEFFILREKDIIALGTLQPEY 93
gi 75095865   19 VLKLVSGEEVLGKAVLTNEGNETLCFIQNPIAVQMVERELDGDRLARGIGFSKWMQLSDEDFYVIREKDILTISAMSKQC 98
gi 326782592  14 IFKLVSGEEILAKAVLTDDNGETLCFISDPVMIQTITKEIDDTKVLRGMGFTKWMPMSDEEFYILREKDIMTIASMSSPV 93
gi 418487500  14 IFKLVNGEDVLGKSLITEDNGESIVFIQDPVTLEIFTKDLDDGKVARGMGFAKWMQMSDEEFFMQREKDIISLATMSKET 93
gi 460042786  14 VIKLTNGEEILAKAVLTEDEGETLIFVSSPVLIQNVMKELPDGKVLKAMGFARWMQMSDEDFFILREKDIITIASMSREV 93
gi 326784306  14 IFKLVSGEEILAKAVLTEDKGESLIFISDPVSVQAITKEIGNEKVVRGMGFTKWIPMSEEDFYILREKDIMTIATMSKPI 93
gi 326783534  14 IFKLVNGEEVLGKAILTQDETETLVFIQDPVCVQVVTRESEDGKVTRGMGFTKWMQLSEEDFYIIREKDIITVSSMSKEV 93
gi 514050877  14 IFKLLNGEEVLGKAVLTEDEGQTLVFIQDPVCTQIVTKETDDGKTIRGMGFAKWMQLSDEDFFILQEKDILTVTSMSKEI 93
gi 564272080  14 IFKLVNGEDVLGKSLITEDNGESIVFIQDPVTLEIFTKDLDDGKVARGMGFAKWMQMSDEEFFILREKDIISLATMSKET 93
gi 418487283  14 IFKMTNGEEVLSRAVITVDQNESLIFLQDPVMVHVMTKPMSETKMVRGVGFVKWQQLSDEEFFVVKVKDVVCIATMSREV 93

                 ....*
gi 122147513  94 VIMYE 98
gi 75095865   99 IFMYE 103
gi 326782592  94 VLMYE 98
gi 418487500  94 IFLYE 98
gi 460042786  94 MFMYE 98
gi 326784306  94 VLMYE 98
gi 326783534  94 IFMYE 98
gi 514050877  94 SYLYE 98
gi 564272080  94 IFLYE 98
gi 418487283  94 QLLYE 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap