Conserved Protein Domain Family
DUF4901

?
pfam16244: DUF4901 
Domain of unknown function (DUF4901)
This family consists of uncharacterized proteins around 470 residues in length and is mainly found in various Bacillus subtilis species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318478
View PSSM: pfam16244
Aligned: 4 rows
Threshold Bit Score: 353.031
Threshold Setting Gi: 228707128
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81581325   14 H-----IINIPDDYRLVVDDQEgv--dDPYHLLWWEHKADEERTIQITLNRHTGSLIDFRIEDEK--AFSSSEKAIE--- 81
gi 493570777   9 RekassIVSIPENYHLVVEDNI-----ADERLFIWEDPQHPEANIEITLDLQTGELIKLSIDKNQdnACSGADCAIPs-- 81
gi 506216083   9 RsaagtITLIPEHYELVMEDNTpkgfdEKERTFIWEDPHSENSRIEVSLSLETDQLMRLQIDQERddTIRGS--AIEagr 86
gi 228707128  15 H-----MIDIPDEYRLVVDDQEdv--dDPYHLVWWEHKEDEERTIQITLNRHTGNLIEFSIDGEI--YFSSGKEAID--- 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81581325   82 -DNQAREIANTFLKKYTKEGSEFYTYVIVKGDKHgWKEVNYMQEVNGYPLPNTGCVVQVHPSGNVVDF---HYNGQkaie 157
gi 493570777  82 -ADQAKRIADEFIKQHLPDLRGEYTWIHIEAGRR-HMHISYRQETGGLPLPFSGCNCTVDSGGNITDFk--HYGCK---- 153
gi 506216083  87 tTEQAADIAKAFMIRHHPN-YAALTWIRSEIKRN-YVEIEFRAEVGGLPLPSSGCEIRLDADFNIVLYkaeEFPGM---- 160
gi 228707128  83 -ENKAREIANAFLKKYTKEGYEFYTYITVKDDRRgWKEVNYMQEVNGYPLPNAGCVVRVHPSGNVVHF---RYNGQkaie 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81581325  158 KKPSWPNEIVEENVVLENLKARQDMRLVFVDLTYSSCGYENREevkgYHLVYEPEPSHACIDASTGKDLYGPEHYKLPPT 237
gi 493570777 154 NKPAWPASITDVKTVKQQIVEDLRMKLCIMRLYPSMHEVEDLE----YRLVYEPVPCLRSFNAITGRDLFEPDHYLMPRS 229
gi 506216083 161 ELPVWPDRLVSAEAAKQRILQDMEMQPILTTLYPSIYDMEGGEd--qHRLVYEPIQGRRKIDAVTGEPLHNLQHDLLPPT 238
gi 228707128 159 KKPLWPSEIVEENVVLENLKARQDMRLVFVDLTHSSCKYENGEevkgYHLVYEPEPSHAFIDASTGKDLFGTDHYKLPLT 238

                 .
gi 81581325  238 V 238
gi 493570777 230 H 230
gi 506216083 239 V 239
gi 228707128 239 V 239
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap