Conserved Protein Domain Family
DUF4903

?
pfam16246: DUF4903 
Domain of unknown function (DUF4903)
A small family of uncharacterized proteins around 210 residues in length and found in various Bacteroides and Prevotella species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318479
View PSSM: pfam16246
Aligned: 6 rows
Threshold Bit Score: 337.224
Threshold Setting Gi: 81315293
Created: 1-Aug-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81315293   26 CDSDEKITQEPPSQTYVKKAKEILAGDIVLSTRATMNGVDKTLLKSGCPTKFNFSWREDGMMILN--LSDFSVGAMPFAI 103
gi 496520081  24 CQSDDNLEKKDTSEDLVAMAHQYLNGDIILGTHATMNGVNKTLLPQGCPTKFNFRWSETDKNVLTirLEDFTVGQMPFSI 103
gi 355369147  11 CNSDDNLEQKAPAQEYLKEAKDILSGDIVLSTKATMNTVDKTLLPQGCPTKFNFNW-EKDSLRLT--LDGFTVGKMPLIV 87
gi 524021205  22 CSSDEEITQGDADEELVESSKSFLNGEIVLSTKATLSGVDKTLLPEGCPTKFNFKWSDKDSQKFTisLLDFTVGNMGMII 101
gi 503312757  23 CSSDEKITKAGASDELVASAKSYLNGEIVLSTQATMNGVNKTLLETGCPTKFKFEWSNTDTQTFTvaLLNFTVGKMGMII 102
gi 524349127  26 CSSDEEITDADANTELVKEATNYLNGEIVLSTNATMNGVNKTLLPEGCPTKFKFEWSKTDAQTFTisLLDFTVGNMGMII 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81315293  104 SFKCATKIMQLNSWEQDEYPGDGWIKFVGTDGNVTtsGDDAEDN----------QEGSGARVDGYLNVNTNQIEFIVDYN 173
gi 496520081 104 TYYCDVKIIQLNSWEKNEYKGDNWIKFVGEDGYLA--LGKGGQP----------RPMKGSSVKGYYNVKTHEINFIVDYN 171
gi 355369147  88 YFSCKCKFMQLNSWEKDEYKGDGWIKFKGKDGSVT--GNPKdDSg--------vQQGSGAGVEGYLNVKTNQITFIVDYN 157
gi 524021205 102 NYKCEVTCMVLNSWEQKEYKGDGWIKFKGENGSCW--GTEQ-DGssfdgdgtngSVVNGSSIQGYYNAKTHQIQFIVNYN 178
gi 503312757 103 NFKCDVKTMQLNTWEKDEYKGDSWIKFYGENGSCW--GVDTtDGt--------aSTAQGSSVKGYYNVATHEINFIVDYN 172
gi 524349127 106 NFKCDVKTMVLNSWEQKEYTGDGWIKFKGEDGSVW--GTDT-DGs--------aSSAKGSSVQGYYNAKTHEIQFIVNYN 174
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 81315293  174 MMNVRTETFLQTIDKTRIDRFKEEFAQYEKDLEEAKKDQG 213
gi 496520081 172 MMNVRSECFLQPIDKARINNYEAELKKYEADLAAYKKEHG 211
gi 355369147 158 MMNVRSECFLQTIDKNRINNYEAEFAQYEKDLAAYKKEHG 197
gi 524021205 179 MMNVRSECFLQTIDKSRLATFDADKAKYEADLAAYKKEHG 218
gi 503312757 173 MMNVRSECFLQTIDKSRLDNYEAEKAQYEKDLAAYKKEHG 212
gi 524349127 175 MMNVRSECFKQTIDKSRLATFEADKKKYEADLAAYKKEHG 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap