Conserved Protein Domain Family
DUF4908

?
pfam16252: DUF4908 
Domain of unknown function (DUF4908)
A small family of uncharacterized proteins around 260 residues in length and found in various Caulobacter and Brevundimonas species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318482
View PSSM: pfam16252
Aligned: 4 rows
Threshold Bit Score: 329.131
Threshold Setting Gi: 501513058
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81536069   66 SLRDALLGHKGQGeARRAPAPPVARYVSETGGAFVFDQAAPRPLIKFDNSAEIWVLQAQPASRGDVIYRNDLGEPVLRVT 145
gi 501513058  33 SLREGLFGRHAGS-GRQAPAPPVARYVAEDGRMFVLDRTQGRPLLKFEDSPEVWALQPMPAPRGDVIYKNDLGEPVLRAT 111
gi 503243699  42 TLRDSLIGRVTPNdGRTNAPPTVARFTTDRGASFVLDRSRRNPLIQFDGDSEVWALTPTPGPMGDIIFKNDLGEPVLKAT 121
gi 501245491  41 NLRESLFGNRGGSeARKAPAPPIARYVSETGDAFILDRAAPQPLMKFENSSEVWVLSPQPAPRGDTIYKNELGEPVLRAS 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81536069  146 KLGGIILFTDDAPMGAAVALSGRAQSIQPpAMLSFNVFVQRVRIATARASRAAQRDIEFATvqDVRPETSVLAADTATIV 225
gi 501513058 112 RLGGLTVFTDARPQGTAAALAGDGPPLRL-APIGPQALLERLAQASLRASRAARRTILFEA--EATPASSALIADAATVT 188
gi 503243699 122 RWGGMILFSKDRPTGDPVAVAGRAEAFEP-GHMSPSQLFQHLVRTSKKASAALSRLVRFEAd-VQTPGADYLFADAATVT 199
gi 501245491 121 KLGGMTLFTTERPGGDAAALMGKATSIQPpPFISVNALFQRLVQASARASRAAQHRIAFETvdDATPATSVLVADTATVT 200
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 81536069  226 AEAFERMARKGD-RSLISGIARVLLAEGHKPSASLKDGALTITYSPEQGLAGRPSSKRIIKV 286
gi 501513058 189 SVAVVRMSRRKDgRAVLAQFRKVLLVEGRRPAAEIEDEVLTITVAPAQGLAGRPSSERIVKV 250
gi 503243699 200 ADAIVEMSATTKgRKLLAPVQEVKLIEGRPPSAWVEGDTLMLKLDLSKGWGGRPSSKRVMKV 261
gi 501245491 201 AEAFEKMARNGD-RNLLSRVVRVLLAEGHKPGASLKGGDLMVTYAPNRGLAGRPSSKRIIKI 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap