Conserved Protein Domain Family
DUF4914

?
pfam16260: DUF4914 
Domain of unknown function (DUF4914)
This family consists of uncharacterized proteins around 630 residues in length and is mainly found in various Thermotoga, Thermoanaerobacter and Carboxydibrachium species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318489
View PSSM: pfam16260
Aligned: 27 rows
Threshold Bit Score: 1129.65
Threshold Setting Gi: 504249720
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600   27 EIIEKASSITIPESRNHLLEISM---GGKEDw--FEIVYEVPGKGRVLEGTVAKCKNGLAVNFPEPYMRRREPDCLVVAD 101
gi 502808713  25 rVLAAAPSVAVPETLADLRELAL---RDVDSqgwHEVAYEVPGQGRVVEARVCKVNNGIAANYVDPYMRRRDPDCMVIGD 101
gi 503170653  18 ELLEACPNYIVAHKEEELVDLAV---RDAKNg-cQEVKYDIPGQGEVVEAVVCKVRNGISANYPDPYMRRRDPNCMLIAD 93
gi 503329548  20 QAAEDANRLTFVESVEELVELAApadRCDPRg-yFTVGYDVPGRGFVPEAKVCRVRNGIAANYLEPYMRRRDPDCMVIAD 98
gi 504249720  17 AVLEAAPKVHYASSVAELAALAVp-eGETDGrgfFEVGYDAGG-AWKREAEVCRVKNGVAANYLDPYMRRRDPDCMVIAD 94
gi 753859466  16 AIVDCSPSVIVPESKETLYELIF---GNEHTn-rIDVVYDVEG-QPVHEADVVRCKNGAVVNYSEDYMRRRDPDCMRIAD 90
gi 503037331  16 DILVQSKGVVIPKTREELLALAM---GNAENt-eFHIEYEVEGKGTVLEATAIKCKNGVVVNYTDDYMRRRDPDCLLIAD 91
gi 503424250  16 EILEESPHIVFPRSKEELVNLSF---GDTSGd-vYDVTYETPGHGMVTEATITRCKNGVVVNYPDDYMRRRDPDCLLVAD 91
gi 740775875  25 KVLSACQSFTCYNTTEELADAAT---CGKENn-eFAVSYDIEGKGTFTEAIVHRVQNGISVNYTEAYMRRRDPGTMVIGD 100
gi 501224382  17 DILQSCPNFTLAADVEQLIELAV---KDAKNg-yHEVAYDIPNRGKVVEALVCRVRNGISANYTEPYMRRRDPDCMVIGD 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  102 EGETDKPRFKDRYGYD---FDTLRKETFEWLKGQKLIVMPFMSGGEELGYPSLLIAPENAGFFATALADIQGFIPANEIP 178
gi 502808713 102 SGATDKPTYEGRFGKS---FDPLREESLEWLAGQPLAVFPFRAGMDGKGTDAIVVAPDNAGFFALGLALLQGMLLPGDVP 178
gi 503170653  94 DQPTDKERYENRFGED---FSGVREETFDWLKEQELAVFFFETGPSGLGVKAMAIAPANAGFFAFGLALLQGIVDTRELE 170
gi 503329548  99 DKATDKPTFRGRFGTD---FAPLRLETLEWLKTQPLACFFFESGLPGHTLNALAICPANAGFFALGLAMLQGIKPLSHLQ 175
gi 504249720  95 ARATDKATWDERWGKDlggFEQTRQATFEWLKGQELICQFFSTGMPGQALQAVAICPRNAAFFAAALAMLQGIKPIDEVV 174
gi 753859466  91 DQPTDKPRFEDVYGYS---FDEVRKETFQWLSTQELILVPFKAGGYDYGYEAALVCPRNAAFFAFALSQLQAFVNIRKL- 166
gi 503037331  92 KKPTDKPRYEDVCQSD---FESLREQTFDWLKKQELIFFPFKSGGLEYGYDSILIAPSNAGFFAAGLGDLQGFLNIDEIS 168
gi 503424250  92 DNDTDKPKYDDVYREN---FEGLRNETFDWLKGRNLIVLPFKAGGDQYGYDALLIAPANAGFFACGLADLQGFLNIEELD 168
gi 740775875 101 DKPTGKQRFSEKYNYP---FSDIQKETFDWLKENDLAVFFYFAGRQGIGSLGIAIAPANAGFFAMGLSMLQEIVAIDELA 177
gi 501224382  93 DLPTNKPTFKSRFGFE---FEELRQQTFAWLKTQELALFTFVAGVKGKGPDVVVVAPANAGFFALGLSLLQGIDDPSEIG 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  179 ---E---GFTPRAIVYLAPPFRHTHFNGKQVVVHNRL----KN---LHELFSYNLYLGPSAKKGIYGVLLTIGE--K--E 241
gi 502808713 179 ---A---GFSPKAVIYVMPPFRHTHFEGKQVVVHNRL----EG---MHELFSYNLYPGPSAKKGIYGVLLNLGE--Q--E 241
gi 503170653 171 ---K---DFVPESFIYIAPPFRHTHFDGKQVVVHRRL----KN---KYEMFAYNLYPGPSAKKGVYGMLINQGV--E--E 233
gi 503329548 176 cqgE---DYRFGAVVYTAPVFRHTHFDGKQVVVHNRR----LEevgIHELFSYNLYPGPSAKKGVYGMLLTLGE--KaeE 246
gi 504249720 175 ---AegaAYHHGAIVYVAPPFRHTRFGGKQVVVHNRRfdggYD---LHELYSYNLYPGPSAKKGVYGMLLTAGErdE--Q 246
gi 753859466 167 ---K---KFTPRAIIYVAPPLRHTRFNGKQVVVHSRS----RD---LHEIFSYNLYPGPSAKKGVYSVLLDIGE--Q--G 229
gi 503037331 169 ---S---DFKPKAIVFLAPPFRHTHFDGKQIVVHNRL----NE---IHEVYSYNLYPGPSAKKGIYGVLLNIGE--E--E 231
gi 503424250 169 ---P---AFSPKAIIFLAPPFRHTHFGGKQMVIHNRL----EK---VHELFSYNLYPGPSAKKGIYGVLLNIGE--S--E 231
gi 740775875 178 ---E---NSELKSVIYVAPVFRHTHFDGKQVVVHNRL----DD---IHELYSYNLYPGPSAKKGLYGVLLTQGE--K--E 240
gi 501224382 170 ---S---DFLPGAVLYVAPPFRHQVFQGKQVVVHNRR----PG---LHELFSYNLYPGPSAKKGIYGVLLAMGE--Q--E 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  242 GWITAHASAVRVITPYDNILTIMHEGASGGGKSEMLEQIHREPDGRIKVAKNIVTGEEIYVDLKEACELQPITDDMALCH 321
gi 502808713 242 KWITMHCSTAEVVTPYDARIVISHEGASGGGKSEMLEQAHRQSDGSLLLGVNTLTGDRRSLSLPQTCGINPVTDDMALCH 321
gi 503170653 234 EWVTLHCSAVQVVTPYGNTVNISHEGASGGGKSEMLEDMHRERSGRLLFGKNLMTEEKYRITLPQGCGLRPMTDDMAICH 313
gi 503329548 247 PWTTAHCSTVQVITPYDNTTTIMHEGASGGGKSEMLEVMHRELDGQIRLGTNVITGDQRFLTIPRGCELRPVTDDMALCH 326
gi 504249720 247 SWTTAHCSTVQVVTPYDNVTTIMHEGASGGGKSEMLEQMHREADGRLRKGTNVVTGETRYMTLPHGCELRPVTDDMALCH 326
gi 753859466 230 GWVTAHASAARIITPYENEMVMMHEGASGGGKSELLEDVHRESDGRVLVGVNTISGTRHYISMSDTCTIQPVTDDMAICP 309
gi 503037331 232 GWVTAHASTVKVITPYDNEIVIMHEGASGGGKSEMIEDIHKEMDGRAILGRNTVTGEKNYLVLNETCDLIPVTDDMALCH 311
gi 503424250 232 GWVTVHASTVKVVTPYDNEIVIMHEGASGGGKSEMLEGIHKQLDGRIVLAENTQTGEKTYIKMDENCAIYPITDDMAICH 311
gi 740775875 241 EWVTAHCSAVQSISPYDIVTTFMHEGASGGGKSELHQHIVRETDGRVLLGKNSVTGETRYITIPRTCNFLPIADDMAFCH 320
gi 501224382 233 NWVTAHASTVQVITPYDNKVTFMHEGASGGGKSEMLEPAHRRPDGSLLLGKNLVTGDERHLILPKTCDLRPVTDDMALCH 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  322 PALQ--Q-----------GK---KLVIKDAEKGWFIRVDHINEYGTDPHFEKLCIYPPEPLIFLNIDGVPKSTCLIWEHI 385
gi 502808713 322 PSLD--Pg----------NG---KLGLTDAEDAWFLRVNHIDRYGIDPHLESLTIAPPEDLLFLNIQAQPNSTALIWEHI 386
gi 503170653 314 NSLQ--Kn----------NG---KLTLMDAENSWFVRVDHINKYGTEPNLEAITADPDKPLLFLNIDAAPNSTALIWEHI 378
gi 503329548 327 PKLQ--Qa----------EGaprKLTLIDAEQGWFVRVNHITHYGTDPNLEGLTIDPPGPLLFLNIDAVPDSTALIWQHT 394
gi 504249720 327 PSLQ--QpghaersgpgsPK---KLTVIDAEQAWFLRVNHIEAYGTDPHLEALTVHPKTPLVFLNIEAHPGATALIWEPV 401
gi 753859466 310 PVFQ--Pa----------NG---KLALADGEDGWFVRVDGITEYGCDPLYERITIHTKEPLIFFNLDGVPDATCLLWEHT 374
gi 503037331 312 PKMQ--Nd----------SK---KLVVKDAESAWFLRLDNIKCYGTSPQYEKILIQPEEPLIFLNMQAVPGATCLVWEHT 376
gi 503424250 312 PDMQ--Nd----------SK---KLVVKDAEAGWFLRLDHITGYGTSPQHEKIFTQPEEPIVFFNIDAVPGSTCLVWEHI 376
gi 740775875 321 PSFQ--Kk----------NG---KLGIMDAENAWFVRVDSVNQYGDDPVLEKATIHPKKPLLFLNIDTKPESTALIWNHI 385
gi 501224382 313 PSLRqpKn----------QD---KLALMDAENAWFVRLNHITHYGTDPYLEELTIHPPHPLLFLNIEARPESTALIWQHI 379
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  386 MD------APGKPCPNPRVIMPRRFMPNVVDEPVEVDIRSFGVRTPPTSREKPSYGIIGMVHLLPPALAWLWRLVAPRGH 459
gi 502808713 387 ED------EPGSPCPNPRVIVPRSAIPDIVDKPVEVDIRSFGVRCPACTAEQPTYGIMGMFHVLPPALAWLWRLVAPRGH 460
gi 503170653 379 ED------EPNKPCPNPRVTIPRDIIPDVLKEPLSIDVRSFGVRVPPCTKENPTYGILGLFHVLPPALAWLWRLVSPRGH 452
gi 503329548 395 LD------APGSPCPNPRVILPRHYVPGVVNEPVTVGIRSFGVRCPPCTRHQPTYGILGLFHVLPPALAWLWRLVAPRGH 468
gi 504249720 402 IDreatetTPAVPCPNPRVVLPRADYPGIVDEPVTVDIRSFGVRCPPCTADRPTYGIMGLFHVLPPSLAWLWRLVAPRGH 481
gi 753859466 375 LD------STGKPCSNPRVIIPRRLVDNIVTQPVEVDVRSFGVRMPPSTAQYPSYGIVGLLHILPPALAWLWRLVAPRGY 448
gi 503037331 377 LD------QNGKPCPNPRVILPRRLVPKAIDMPVEVDVRSFGVRTPACTKENPTYGILGILHILPPALAWLWRLVAPRGF 450
gi 503424250 377 KD------SDGKPCPNPRAILPRRLVPDVIDEPVEIDVRSFGVRTPACTRDNPTYGILGMFHILPPALAWVWRLVAPRGH 450
gi 740775875 386 ED------EPGKPCPNPRVVLPRESVENTINGSVSVDVRSFGIRTPKCSKEDPTYGIVGLFHVLPPALAWLWRLVAPRGH 459
gi 501224382 380 ED------EPGKPCPNPRVVIPRDIIPNVVNGAVSVDIRSFGVRTPPCTKERPSYGIIGLLHLLPPALAWLWRLVAPRGH 453
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  460 ANPSIVGAEGLESEGVGSYWPFATGKMVTHANLLLEQIINTPGTRYILVPNQYIGVWKVGFMPEWIAREYLARRGSVRFR 539
gi 502808713 461 ANPSIVDTEGMSSEGVGSYWPFATGRRVDQANLILEQIVNTPAVDYILVPNQHIGAWEVSFMPQWITREYLARRNGAKFS 540
gi 503170653 453 GNPSIITGDGMSSEGVGSYWPFATGKKVDQANLLLEQIIETPKVKYIVTPNQHIGAWKVGFMPEWITREYLARRGGAWFT 532
gi 503329548 469 GNPSIVATEGMQSEGVGSYWPFATGRRVDQANILLRQIMETTSTLFVLIPNQHIGSWKVGFAPQWIAREYLARRGSSLFR 548
gi 504249720 482 GNPSIVDRGGMTSEGVGSYWPFATGRRVDQANILLDQILRTSDTLFVLIPNQHIGCWEVGFAPQWISREYLARRGSAAFR 561
gi 753859466 449 NNPSVNGDSPLAAEGVGSYWPFATGLRVRQANLLMEQILRCTATRYVLIPNQNIGIYKVGFAPEWISREYLARRGGVNMR 528
gi 503037331 451 NNPSIIDSLEMTSEGVGSYWPFATGKMVTQANLLLEQILHSTNTRYVLIPNQHIGAYEVSFMPQWVAREYIARRGSAKFK 530
gi 503424250 451 NNPSITASTGLVSEGVGSYWPFATGKMVEQANLLLQQVTANSNTRYILIPNQHIGVYKVGFMPQWIAREYIARRGSAKFK 530
gi 740775875 460 KNPSIVGTGAMESEGVGSYWPFATGDRIIHANLLLKQIIETPRTIFSLVPNQNIGVWEVGFKPQLLMREYLTRRGGAKLK 539
gi 501224382 454 ANPSIVEKEGMSSEGVGSYWPFATGRRVIQANLILQQILTTPKVRYTLCPNQYIGAWEVGFMAQWIAREYLARRGGEKFS 533
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81480600  540 PDQITPARSSLLGYALNTLKINGNFIPKELLQVNRQPEVGDEGYDKGAQILNEFFKRELKKFLVPELNPLGRKIIETCLE 619
gi 502808713 541 ENQVVPSRCPLLGWSPDSMMVESRQIGSWFFQVEKQPEVGVEAYDKGAEILREFFLRELAQFDSPDLLPLGKQIIQCCID 620
gi 503170653 533 KDQLRPARMPLLGYSLKELLVEGQQIEKEFLQVHRQAEVGEKAYDIGGKILSDFFKKCVREYLEPGLHPIGEEIIKTCLN 612
gi 503329548 549 KDELIPSRCALLGYHRHTIQVEGQTIGTWFFDVSSQPEVGEEAYFAGARLLTDFFHQQLRQFLHPDLDPLGRDMIQACLD 628
gi 504249720 562 PGDLVPARCPLLGLHKETIQVEGQVVGTWFTDVSKQKEVGEAGYDAGADILKGFFAKQLADFDHPELDPRGKKIIAACLR 641
gi 753859466 529 MDRLVSSPCPILGYCLKDMKVDGQHIPPKFLRPELQELLGKEGYEVGKKILTDFFAKELKVYDTPELHPVGRQILDCFAS 608
gi 503037331 531 PEHLVEARCPLLGFGLDSLKIDGQYIRRAFLRPETQQEVGTQGYDAGAKILTDFFQQELMKYYTDDLDPLGKQIIDMFLA 610
gi 503424250 531 QEHLVETRCSLLGYSLDSIKVDGQYVRKAFLYPERQGEIGVEAYDKGAAMLNEFFKKELEKFNTPELDPLGAKIIELVLS 610
gi 740775875 540 DDQIQAARCPLLGYELNYLTIESSKIPSRFLKVYNQVEVGTEGYDAGAEVLQEFFNRELKKFMHKDLFHTGRKIIDACLS 619
gi 501224382 534 RQQVVPSRCPLLGYTFRSMMVEGQTIGNWFFRVNLQPEVGNEAFDRGTTILKEFFAGQLRQFLEPDLDPLGKTIIDCCLS 613
                        650
                 ....*....|.
gi 81480600  620 DGTLEDYIKLL 630
gi 502808713 621 GGSAADYDKLL 631
gi 503170653 613 DGKVEDYCDLI 623
gi 503329548 629 GASLEEYAAFT 639
gi 504249720 642 GADVDAYRSLs 652
gi 753859466 609 GGSVEDYCGII 619
gi 503037331 611 GATVKEYLEII 621
gi 503424250 611 DAKVQDYVDLI 621
gi 740775875 620 NASIEEYNQII 630
gi 501224382 614 DASLEDYERLI 624
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap