4KTB


Conserved Protein Domain Family
DUF4916

?
pfam16262: DUF4916 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF4916)
This domain family consists of uncharacterized proteins around 175 residues in length and is mainly found in various Streptomyces species. The function of this family is unknown. This family is related to the NUDIX hydrolases.
Statistics
?
PSSM-Id: 318491
View PSSM: pfam16262
Aligned: 27 rows
Threshold Bit Score: 259.113
Threshold Setting Gi: 644256651
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KTB_D        21 PVGWLDAHRXDEVRSLLPLVYVDAVPVRVDESGDVIQVGLLLRATESGHX-XRALVSGRVXYHERVRDALVRHIEKDLGP 99
gi 81753843   42 PPGWLGPSDINRARHQMPIAYVEIVPVRTDEMGRISQVGSLLRVSEDGSI-ERTLITGRVLYHETLREAIARNVAKDLGD 120
gi 408465450  57 PPGWLDRDAIDRARRCLPMPYVEVVPVRVDDMSAVTQVGTLLRVDDQGNI-ERTLITGRILYHETIREALARNIAKDLGQ 135
gi 240249777  35 PPGWLGADDIADLRSRMPIAYVEIVPVRVDDFGRVTQIGSLLRVANDQSIvERTLIAGRVLYHESLREAIARNISKDMGE 114
gi 506363495   9 lGPWLSPDDLDFVRRKVPMVYVDVVPVRLDDDGLVASVGVLLRVSRDGGI-SRALVSGRVLYHESVRDALARHLEKDLGP 87
gi 504190182   9 gAGWLSREDMDAARERLPILYVDVVPVRVDGHGVVTAVGLLLRAGEDGQI-KRALVSGRVLYHERVRAALVRHVEKDLGP 87
gi 506256245  10 EGSWFEPEHIAELRRRLPIPYVDVVPVRTDVDGSVVEVGLLLRASGAGRI-VRTIVSGRVLVHETLREAIARHVEKDMGP 88
gi 505262845  40 PPGWLDSGEITRIRRETPMPYVVVVPVRVDDFGRISKVGSLLCVSEDGSV-ERTLIAGRVLYHESVREAIARNISKDLGD 118
gi 502935339   9 MGPWLSPEELEFVRNKVPILYVDILPVRIDDAGRIEAIGLLLSAKEVG-I-TRSIISGRVLVHETIRDAIIRHVDKDLGL 86
gi 644256651   9 MGPWLSPEDLAFVRRKVPMLYIDAVPIRLNDDGSLSSLGLLLTASPEG-L-TRSLVSGRVLYHETVREALRRHLEKDLGE 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4KTB_D       100 VALPSIPASPQPFTVAEYFPTPGVTPFYDDRHHAVSLAYIVPVRGDCSPQQNNLELTWLTPEEACSPRI-LAHXQGGQDX 178
gi 81753843  121 IALPLLPIGLQPFTVAEFFPTPGLSEYYDPRQHAIALCYVVPIAGDCKPQDETLDVEWVDPKSDVMDTF-VAQMVNGHGR 199
gi 408465450 136 LALPMLPASPQPFTVAEFFPTPGVSEYYDPRQHAIALCYLVPVAGDCKPQDETLDVEWIDPKGDMLESF-MSQMPGGHGK 214
gi 240249777 115 LALPVLPQTLTPFTVAEFFPTPGVSPYFDARQHAIALCYVVPIAGDCKPQDETLDVEWVDPHGPQITEF-IEQMNDGHGT 193
gi 506363495  88 MALPRLPLSPQPFTVAEYFPTPG-TGFHDPRQHAVSLAYLVPLDGDAAPQQDALELAWLSPAEAVDPRI-QAEMVSGHAA 165
gi 504190182  88 LALPRIPPAPQPFTVAEYFPTPGVTPFHDPRQHAVSLAYVVPVAGDCAPQQDALELTWFAPDEARDPGV-LAELANGQsa 166
gi 506256245  89 MAMPRIPVSPVPFTVAEYFPTPGVSPFHDPRQHALSLAYVVPIDGETAPQEDALELTWFEIDELLAETSpLHEMDGGRDL 168
gi 505262845 119 IALPTLPQSLQPFTVAEFFPTPGISPFYDPRQHAIALCYVVPIPGDCKPQDETLDVEWCDAQGEQLTEC-IDQMANGYGE 197
gi 502935339  87 MALPQLPANLTPFTIGEYFPTPGE-GWHDPRQHAVSLAYIIPMAGDCSANADALEVSWFPPRDLLTRSL-QSEIVATHLP 164
gi 644256651  87 MVLPQLPPTLVPFTVTEYFPTPG-AGGHDPRQHAVSLCYIIPVLGDCNVSSDSLEVNWFTPGELRTPEL-QSEILPRHLL 164
                        170
                 ....*....|.
4KTB_D       179 LLKQALAHAGR 189
gi 81753843  200 IVRQALAWAGI 210
gi 408465450 215 VLMSALTWAGA 225
gi 240249777 194 IVRQALAWVNl 204
gi 506363495 166 LVTTALAHTGR 176
gi 504190182 167 lllqalahlgv 177
gi 506256245 169 LVRRALAHVGV 179
gi 505262845 198 IVRRALAWAGA 208
gi 502935339 165 LVKRALSYLGI 175
gi 644256651 165 VVRRALATLGe 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap