2M0G


Conserved Protein Domain Family
SF1-HH

?
pfam16275: SF1-HH 
Click on image for an interactive view with Cn3D
Splicing factor 1 helix-hairpin domain
This domain, approximately 100 residues in length, is mainly found in splicing factor 1 from yeast to human. It is a helix-hairpin domain, which forms a secondary, hydrophobic interface with U2AF65(UHM) to lock the orientation of the two subunits, which is essential for cooperative formation of the ternary SF1-U2AF65-RNA complex. In this domain, it contains a highly conserved SPSP motif in its C terminal and phophorylation of SPSP motif induces a disorder-to-order transition within a novel SF1/U2AF65 interface, indicating a phosphorylation-dependent control of pre-mRNA splicing factors.
Statistics
?
PSSM-Id: 318504
View PSSM: pfam16275
Aligned: 98 rows
Threshold Bit Score: 83.3876
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2M0G_A         18 KRSRWNQdtmEQKTVIp-gMPTVIPPG---LTREQERAYIVQLQIEDLTRKLRTGDlgi----ppnPEDRSPSPEPIYNS 89
18_pfamImport   1 RVSRWDRkirDVLPN----IPVHIPPS---LDEKYWDTLAIRIRYEELQYALGTHRlgl-----ntERDRTPSPPKQYNE 68
66_pfamImport   1 KKSRWAPagsTPAVN----VANLM------MAQPQQKALLLRTKLEAINQKLATVSadaa--riekDPNRSPSPPPQYDS 68
56_pfamImport   1 KKSRWAPap---------sASSTMAGL---LTQKQQQTVVLRSQLDNINLKLKTVAmdaa--liekDPNRSPSPPPQYDS 66
24_pfamImport   1 KKSRWAPas---------gASSGMTGL---FNEKQQQSVILRAELETINQKLKTVVmdaa--lvekDPSRSPSPPPQYDS 66
70_pfamImport   1 RKSRWADdepKPVIQ----LPDFMKDFaggIEFDP-EVQALNSRLLEISRKLQSGMpld----drpEGARSPSPEPIYDN 71
69_pfamImport   1 RKSRWAEeepKPTVQ----LPDFMKEFt--ADLDP-EVQALNFRLLEISRRLQSNLpld----drpEGARSPSPEPIYDN 69
83_pfamImport   1 RKSGWAEddtKIKMMGpikLPDFVEELavgLENDP-EVQALNAQLLEINRKLRSGVvlye---nkpYEPKSPSPEPIYDN 76
14_pfamImport   1 RKSRWAAeepKLPLLGqiqLPDFVKELtggVDLDP-ELQALNIKLLDINRKLQTGMvld----pvgDGNRSPSPEPIYDN 75
gi 123454606   12 RKSKWGPedeKTVMSN---VANILPPN---LPPDVLNAFLLRFQLEEVQYKMNHLQeerknilygeTLINNMNP----DQ 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
2M0G_A         90 EGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYK 130
18_pfamImport  69 NQQEI-TREMRREEKLKNERLYVVDRAIEIYPSFRIPAEL- 107
66_pfamImport  69 NGKRTNTREVRMRAALERSRQTTIDELVKVNPMYRPPPDYM 109
56_pfamImport  67 NGKRTNTREVRMRAALEKRRCETIDQLVKANPLFRPPADYT 107
24_pfamImport  67 NGKRTNTREVRMKAALEKRRRETIEELVKINPLFRPPADYA 107
70_pfamImport  72 MGVRINTREYRAREKLNRERQEIISQIIKKNPAFKPPADYR 112
69_pfamImport  70 MGIRINTREYRARERLNKERQEIISQLIQRNPAFRPPADYR 110
83_pfamImport  77 LGIRINTRDCRAREKLTKERQEVISRLVQKNPSFNPPVDYK 117
14_pfamImport  76 MGIRINTREYRAREKLTRERQEVIAMLIKKNPAFKPPADYK 116
gi 123454606   82 RG--FIHPDVRARDALVKERSQILNAIEKIFPVFRPPLSLK 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap