2VXD


Conserved Protein Domain Family
NPM1-C

?
pfam16276: NPM1-C 
Click on image for an interactive view with Cn3D
Nucleophosmin C-terminal domain
This domain, approximately 50 residues in length, is mainly found in Nucleophosmin proteins in mammalia species. Nucleophosmin, a nucleocytoplasmic shuttling protein, is related with cancer and involved in serveral cellluar functions, such as ribosome maturatation and export, centrosome duplication, and response to stress stimuli. This domain has a three-helix bundle which can bind G-quadruplex DNA and the interaction involves helices H1 and H2 of the NPM1-C domain mainly through electrostatic contacts with G-quadruplex phosphates, indicating a crucial role in rescuring its function in leukemia.
Statistics
?
PSSM-Id: 318505
View PSSM: pfam16276
Aligned: 13 rows
Threshold Bit Score: 75.5661
Threshold Setting Gi: 528499273
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*....
2VXD_A         5 EDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS 53
gi 733909027 263 EEIKAKMQASVDKGCSLPKLEPKFANYVKNCFRTEDQKVIQALWQWRQS 311
gi 919184439 229 aDIKSKMMESVAKGVSLPKVQLKFENYVNNCFKGTDPKVVEELWKWRQT 277
gi 847109024 221 DEIKAKMQTSLEKGTVLPKVEVKFANYVKNCFRTENQKVIQDLFKWRQS 269
gi 972976449 213 aEIKAKMMVGVEKGVMLPKVEAKFENFVKNGFKVDDKNTIQELWKWRQT 261
gi 908488844 265 PEIKAKMMEAVKKGVTLPKAQPKFENFVKHGHKVTDPKVIAELWKWRQa 313
gi 432899687 239 PEIKAKIMESVKKGVALPKVQAKFENFMKHGQNVTDAKVISELWKWRQT 287
gi 941791193 246 PQLKIKLMEAMKKGVMLPKVQPKFENFVKNSNKVCDPQIIADLWKWRQS 294
gi 992175370 245 PEIKAKILASVEKGVSLPKLQPKFENLVKNGYKVSDPKVFFVLWllifw 293
gi 554827054 243 PEIKSKLSTAAKEGKPLPKTEPKFENYLRSAFKISDKQVVKDLWSFVQT 291
gi 528499273 248 SEVKSKLTSAAKEGKPFPKTEQKFENFARSSFKISDKQVIKDLWNFVQS 296
gi 47227524  241 PEIKNKLSTAAKEGKPLPKTEQKFENFVKSSFKITDKKVVKDLWTFVQS 289
gi 190238     33 EDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap