4QVU


Conserved Protein Domain Family
DUF4931

?
pfam16285: DUF4931 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF4931)
This family consists of uncharacterized proteins around 270 residues in length and is mainly found in various Bacillus cereus species. Some members of this family are annotated as Galactose-1-phosphate uridylyltransferases, but the specific function of this family is unknown.
Statistics
?
PSSM-Id: 318510
View PSSM: pfam16285
Aligned: 7 rows
Threshold Bit Score: 395.632
Threshold Setting Gi: 501394229
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4QVU_A         9 FLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGSIIWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHXRSLIRF 88
gi 497478943   8 FNTSIGVKKPNSIRDKEQGCPFCEREKLTDILAVEDNIILLKNKFPVLENTLQTVLIESDECSGDISTYSLEHLEKLLSF 87
gi 497760569   9 FISNISIKKPNTIINQTTVCPFCHKENLTDIFDEKGVFIFLKNKYTTFEDAFQTLIIETDSCRENISTYSEEHMRELLRF 88
gi 493203854   8 FNTTLGKKKPENIINKTAPCPFCDRENLSGIVDTDGDLVLLKNKYNVIEDADQFVLIESKVCHSDMPDYSAEHMHRLIRF 87
gi 81583486    8 FLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGPIIWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHMRSLIRF 87
gi 501394229  11 FINSIGKNKPNSFNNNNTECPFCNRNKLTDIIQENGPFVLLKNKFPTLRDTLQLVVIETYDCELNMGNYDSEYMKELISF 90
gi 501989364   8 FNMQIGRKKPVSVNNTETACPFCDRNSLTDVLEQRGSMIWLMNKFPVLEDTHQTVLIETDECQGDWSVYSKEHVRALLAF 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4QVU_A        89 SIKHWLNLQKNEEFTSVILYKNHGPFSGGSLHHAHXQIIGXKYVNYLDNVEQDNFQGVIVQKNEHIELNISDRPIIGFTE 168
gi 497478943  88 GLKHWIEMENSGRFTSVLFFKNHGPLSGGTIAHPHMQIVGLNEVDYTENIREEEFEGLAISQKGRSLLNISTAPKIGFYE 167
gi 497760569  89 AVSHWLDMKKRDEFKSVLLFKNHGPYSGGSIAHSHMQIVGLKNINYEENLKDEFFEGLTIYETNGCVLNLSSKPKASFTE 168
gi 493203854  88 GVHHWQKMQNSGKYETVIFFKNFGPLSGGTLRHPHMQIVGFHSLNENLTFDPLEFEGLTIHEKNDVDFNIATCPRIGFSE 167
gi 81583486   88 SVKHWLDLQKNEEFKSVILYKNHGPFSGGSLHHAHMQIIGMKYVNYLDNVEQDNFQGVIVQKNKNIELNISDRPIIGFTE 167
gi 501394229  91 GLKHWLAIEKSNEYKSVIFYKNHGPSSGGSIKHAHMQIVGLNNIDYRENINEKYFEGIEIFKSECCEVNLSTKPINGFSE 170
gi 501989364  88 GVEKWLEMEQSKSYRSVLFFKNHGPYSGGSIRHPHMQIVGLNDFDYLDQVKDSDFIGMTIDQEAGVECNLSTHPRAGFFE 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4QVU_A       169 FNIIIEDIGC-IDELANYIQQTVRYILTDFHKGCSSYNLFFYYLNEKIICKVVPRFVVSPLYVGYKIPQVSTKIEDVKIQ 247
gi 497478943 168 FNAKLGDMEE-IGAFAAYIQAAVRYILHSFPFKCSSYNLFFYKLGEDIYAKIVPRFVTTPIYIGYSIPQVPNNLEWMKED 246
gi 497760569 169 FNIIIDDLSF-LDIMADNIQKIVHYILNNFYVKCDSFNLFFYDWKGKLICKAVPRFVTSPLFIGFSIGQVSNNQDKIVEH 247
gi 493203854 168 FNVVPKTNEP-LDTVADDIQIAVDYLMHHFNKRCNSYNIFFYQERGVLRAKIMPRFATSPLFIGYNIRFRPSNLEDLRNN 246
gi 81583486  168 FNIIVKDIEC-IDEMANYIQQTVRYILTDFHKGCSSYNLFFYHVSGKIICKVVPRFVVSPLYVGYKIPQVSTKLEDVKIQ 246
gi 501394229 171 FNVIINDDLKnTFSLSEGIRKTVYYILNNYFAKCDSFNLFFYHWNNKIICKITPRFVTSPLLLGYSLKQVSNSLEEIAGN 250
gi 501989364 168 YNVILSDFDR-LPKMADYLQILAHWILTHVNPRHQSYNFFFYHWGEKLIAKVVPRFVTSPLYVGYSIPQVANNLEDMVAQ 246

                 ....*.
4QVU_A       248 LAA-YF 252
gi 497478943 247 IRAkYF 252
gi 497760569 248 VKQlYF 253
gi 493203854 247 VRKiYF 252
gi 81583486  247 LAE-YF 251
gi 501394229 251 LKElYF 256
gi 501989364 247 LQRrYF 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap