Conserved Protein Domain Family
DUF4937

?
pfam16291: DUF4937 
Domain of unknown function (DUF4937
This family consists of uncharacterized proteins around 120 residues in length and is mainly found in various Bacillus species, such as Bacillus subtilis and Bacillus amyloliquefaciens. Several members are annotated as ydbC, but the specific function of this family is unknown.
Statistics
?
PSSM-Id: 318513
View PSSM: pfam16291
Aligned: 12 rows
Threshold Bit Score: 110.161
Threshold Setting Gi: 503911294
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81345914    2 LiKKMICEVDAANAEAFAKAQSQWEALSHISGFIKQAGGWRKtiDEPLTAEIISVWENREAYDHFMENEHDSIYEENDQK 81
gi 81667024  114 L-KLIRCKSAEQKLQAFSEAQAKWAPLQNVSGFIRQWGGWMEt-EDGPEAVVLALWKSKHDYLNFMAEHHDEIYERTHQK 191
gi 122301057   1 -----mCEVDDGKQEAFSQSQSAWSQLSTCNGFVGQAGGWE---ASSSTAIILGFWESQFHVSEFMRTIHDDIYLSNKQQ 72
gi 81364916    3 I-KHITCKVKKEKKDVFSNGQAKWGYLKGLEGFVGQIGGWSD--KQENTAYIFSLWQDKKDYLHFMKNEHDKVAFLTGQE 79
gi 81582316    2 LlKTIYCKVEEEKKELFSMAQEKWRDIQHLDGFHGQFGGWH-----KGEACVFTLWEDRGAYQSFMNGAHDTIYLNSNQE 76
gi 736646427   2 LtKIVKCSIPTDKKASFSYTQQHWAALAHVNGFIGQLGGWNV--EDETDACILALWEDGTTYQEFMKHTHDSIFYKSKQD 79
gi 497481551   2 LvKYIRCGVDSASREEFSLAQMGWEPLKHVPGFIRQFGGWTRp-EGDADAVIFGLWESRASYDYFMSNLHDSLIGASSQM 80
gi 557414540   2 LvKWTRCTVKD--RRGFERGQRKWAGLPGEPGFLGQGGGWSR--SRPDVVHLFTLWESRAFYDSFMARSHDRL--AASQA 75
gi 502818484   2 IaKYIRCDVTSQMRPEFSKGQGLWQETAPCDGFISQLGGWER---TTGKAIILALWRDMNSIQAFMTLEHDVIAENTNQA 78
gi 504506188   2 LlKVIVCEVTD--VAGFAAAQAGWSALRGRPGFLAQAGGWS----DPCTARIVGCWRDRAALRAFMADGHDAI--AAGQR 73
gi 503911294   2 LvKWIRCRVTD--RTGFERGQREWAALFGEPGFRGQGGGWGR--GRPDEAHIFCFWENRSYYDMFMAGPHDGI--AMAQA 75
gi 664526620   2 LvKWIRCTVVD--RRGFERGQRKWAGLLGEPGFRGQGGGWSR--GRQGVAHIFSFWESRSFYDSFMARSHDRL--AAAQS 75
                         90
                 ....*....|.
gi 81345914   82 AVILSIEVTVY 92
gi 81667024  192 GTFESINITLF 202
gi 122301057  73 STYRHCSVNYF 83
gi 81364916   80 GSISSIHIELF 90
gi 81582316   77 DTFLSCEIELF 87
gi 736646427  80 QTYTNLDVSts 90
gi 497481551  81 RYLQSFSAALF 91
gi 557414540  76 GTFAGARVRLF 86
gi 502818484  79 GTYSAISVSYl 89
gi 504506188  74 DTFRRAEVHHF 84
gi 503911294  76 GTYDRMDVRLF 86
gi 664526620  76 GTFKDIQVKLF 86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap