Conserved Protein Domain Family
DUF4959

?
pfam16323: DUF4959 
Domain of unknown function (DUF4959)
This family consists of uncharacterized proteins around 400 residues in length and is mainly found in various Bacteroides, Pedobacter and Parabacteroides species. Several proteins are annotated as Galactose-binding like proteins, but the specific function of this protein is unknown.
Statistics
?
PSSM-Id: 318530
View PSSM: pfam16323
Aligned: 32 rows
Threshold Bit Score: 123.509
Threshold Setting Gi: 764966788
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443811   20 IGCKEDDNIRPFGKDveA--GAPGVVSEIKVKNIPGGAVISYQLPDNPDIMYVRARYKVgQGKEMEARASVYANE-LTVN 96
gi 81443634   19 HSCEDVETHKPYGDGs-G--HAPGTVQVTSYEQIPGGVTLKFIAPTDEDLLYIKIKYTLdNGKEMEARASLYTDE-TTIE 94
gi 81443845   18 GSCAED-MVKPIEND--K--DAPGTVQDVKTESLPGAVKFTYTLPSDPDLLYVLAKYTNkTGKVMEFRSSFYTNS-VTVE 91
gi 753824157  16 VSCEEEP-IGQQPLD--S--VPPGEVTNIESYSTPGGAVIKFTPPKDEDLLYVKAVYSRkEGVVSEAKASKYADS-IEVE 89
gi 523967568   5 SGCADDNHGRIDQLD--KglPAPQPVEVTGVKPTSGGAVLWVRIPDDKNIKGVVATYKr-GGVEVESKISRYVDS-LEVE 80
gi 502836127  19 IACSEEIEQMPLESN--N--IAPEPVSDLNVENLPGKVKLTFTLPKDQDLLYVKANYILpTGREMEVKSSLYSNS-MTLQ 93
gi 524356173  28 CSCNDE--EGRITID--N--SAPAQVTNVQAVAGPGEVTLSWTNPDSPSFMYTKISYTDsKGEEKYVLVAKDKPStATVK 101
gi 524576162  19 VSCGDGNRIDQKG-E--I--AIPQEPTIVGIKSVPGGAVIKVAIPDDPNLKGVVATYQr-NGATVESRISRYLDT-LVVE 91
gi 524421861  25 MGCEEDNLHKPYGPDd-G--IAPGKVEVLSYTPTAGGAIINFRSPDNEDLMYIVAKYKLaSGKEMESRVSAYSSS-LKVE 100
gi 570747374  18 AACKKQSRFETGGSD--N--TPPGKVTLKEYKPLFGGARFFYTVPKDEDLLGVEAVYTNkNGQSFKFMASYFSDS-LDVY 92
                         90       100       110
                 ....*....|....*....|....*....|.
gi 81443811   97 GFGDMNEHEVELSCVDRMENEGATTVAVVTP 127
gi 81443634   95 GFGNTNPKKLVISAVNKMEKEGEAIITEIVP 125
gi 81443845   92 GFGDTDTYKVELYTVDRSENRSQPQIVEVVP 122
gi 753824157  90 GFGSISSQDIELVAVDRSRNSSEPVKISVVP 120
gi 523967568  81 GFADTQEHEIQVCSFNINEDKSTPVTVKFNP 111
gi 502836127  94 GFTGNDDVVVDVVAVNRSEVESEPVSINVNP 124
gi 524356173 102 GFASTDECKFSLYACSVKGNNAGAVEVSFAP 132
gi 524576162  92 GYADENEHDVVIRSFNANDDKSEGQTVKITP 122
gi 524421861 101 GFGDTEEKQITFYAVDRKENIGEPITYNIIP 131
gi 570747374  93 GFGSIDEYNVQLYAVDRSGNKSDVLDVKVVP 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap