Conserved Protein Domain Family
DUF4983

?
pfam16356: DUF4983 
Domain of unknown function (DUF4983)
This family consists of uncharacterized proteins around 600 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
Statistics
?
PSSM-Id: 318554
View PSSM: pfam16356
Aligned: 4 rows
Threshold Bit Score: 146.63
Threshold Setting Gi: 504492535
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 326550916 476 VDENHPYYDYLAGYWPVANDTDGTVRDEGPFGNHLTMTSDdFSYDRLNEYLCAPTTADLGSQVPRTFDVPTQIYTWLKIS 555
gi 763360654 484 LPSSHPYRDYLIGYWPCRDGFGGVFKDQSEYRHDFVIHGA-HQWDDFNDLMCPSTATNLAQLVPQPVDVARQVLNWLQIA 562
gi 504492536 460 VTTSHPKYSNLIGYWKGLNDANKTMIDSSPFARNMTLSGTiNRTNTNSSLKCY-----VAHIVPYMVDYAYSALTWLGVP 534
gi 504492535 460 VTASHPNYSNLIGYWKGLNDVNKTMIDSSPFARTMTLSGTiNRTNTNSSLKCY-----VAHIVPYMVDYAYSALTWLGVP 534
                         90
                 ....*....|...
gi 326550916 556 RQENWQLDGRTWL 568
gi 763360654 563 ADTKWQMDGRVWV 575
gi 504492536 535 ISPSWNLDGRSWI 547
gi 504492535 535 ISPSWNLDGRSWI 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap