Conserved Protein Domain Family
PepSY_TM_like_2

?
pfam16357: PepSY_TM_like_2 
Putative PepSY_TM-like
This is a family of bacterial proteins with three PepSY-like TM regions.
Statistics
?
PSSM-Id: 318555
View PSSM: pfam16357
Aligned: 12 rows
Threshold Bit Score: 240.32
Threshold Setting Gi: 503333253
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81578678   12 YWLKTLHQwhWISSALCLLgMLLFAVTGLTLNNASHIES-RARVDTRHLELPAPLRAELAAAAPAR--P-A--------- 78
gi 81726457   10 TWARRLHI--YISMALLLV-TLFFALTGITLNRPELFERkEPIIQQHTIIIPPQTLFLNGESFQPN--RvA--------- 75
gi 123589124  11 STSRALHI--YISTALFFL-LILFCVSGIVLNHVDWLKN-DKNNGQISTPIPSALA--AKANAQLS--TlPt-------- 74
gi 123276360  19 IYARFLHI--YISTALFAL-LIFFCITGFFLNHLDTFGG-SASDESKEIPFTPALSELFAAENTPF--EnP--------- 83
gi 81355511   31 IVKKQVRLwhWVSAAIFCVtMLLFSVTGFMMNHGHDIFApHLTTTEKQFELPQDLLPALQQPLKKA--DeKsvkvkeggf 108
gi 81659320   22 aaLRTVVLwhWTSSAVCLIgMLGFAITGITLNHASQIET-EPQRDSVIDDLPPKFMSLLANSTEEE--SaA--------- 89
gi 501464689   3 IYVGSIRQwhWISSAICLVgMLLFAITGITLNHASQIPA-TPNITQVETQLPEHLLVLLQGDIENE--KaP--------- 70
gi 503843773  11 WWIKQLHSwhWISAAISLVgMMLFAITGITLNHASSISA-QPRVTEGSVTLPAPLAAQLRGEPPAP--DaP--------- 78
gi 500156633  11 YWLKTLHQwhWISSAVCLLgMLLFSVTGITLNHAAQIES-RPAVTARELQLPPELKALVTPDVLPSspRaP--------- 80
gi 503333253   7 VVSRWLHI--YLSMVSFAL-VLFFSVTGLTLNHTEWFDG-QQRTVTSTGNMPLALL------AKPD--ElR--------- 65
gi 145569591  31 LWLGTLRQwhWISSALCLVgMLLFSVTGITLNHAGQIES-KPQVQSRAAQLPESLLAKLQTETPES--G----------- 96
gi 499839309  15 FWLKHLHQwhWISSAICLIgMLMFAVTGFTLNHAGQIEA-SPSVVTRHETAPRELLDALKRAAPAN--AlAgnqkdq--- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81578678   79 -------------LPPALLEWLDRELDVDARGAAAkpEWSP-----DELYVSLPRPGGDAWLSIDLQSGELEYERTDRGW 140
gi 81726457   76 -------------LIDFLTQEVALRGTPSALDVYT--EVEQgelvlGELSLDFKGPGYNATVFVDMTTGDADIETTNYGA 140
gi 123589124  75 -------------LYPEIEAYLAKQYALTNVKSIEw-EKED-----ALVMLDYPLPAGFAYAELDFISGTLNLDYQTGGF 135
gi 123276360  84 -------------PLAALKQYVQQRHGLSQFNRMEldEDA------GELILDYSLPAGYASAIFLVEDETLLLEYQKGSV 144
gi 81355511  109 dwgqlasqevsqpLPENVVQWLKSQH--LPAKKQA--FWTD-----KFVYFVTPKLGMRDRLLIERDNGHVHYEHTSRGW 179
gi 81659320   90 -------------LPPELAEWLTEQTGKAIGSRKA--DWSE-----DEVYLSMPGPGSDAWLAIDRETGEFEFESTQRGW 149
gi 501464689  71 -------------LPEAVGQWLRDEHRILVAGRAA--EWSD-----GEVYLSLPRPGGDAWMTIDTQAGDVFYEKTDRGW 130
gi 503843773  79 -------------LPGAVADHLREAVSLDARGKPA--EWSA-----DEVYVALPGPGSDAWIAIDRASGAVTSEHTDRGW 138
gi 500156633  81 -------------LPARLADWIQTQIAVDVRGRDA--EWSD-----EELYISLPRPGGDAWLRIDRESGAAEYERTDRGW 140
gi 503333253  66 -------------IVEQIRNVHHVRGAMSDFRTE------D-----NQITVSFKGPGYSADAGITRATGKYELVEVRNGF 121
gi 145569591  97 -------------LPVELRAWLEQTLDIRLAGREA--EWSD-----GELYVALPRPGGDAWLSLSSETGELEYESTDRGW 156
gi 499839309  89 -------kdqkgpVPRVLADWLSKTMDIEAAGREA--EWSA-----DEIYVGLPRPGGDAWLSVALEDGEVQYEVTSRGW 154
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 81578678  141 IAYLNDLHKGRHTGLAWSWFLDIFAVACLVFSLTGLVLLKMHAGNRAATWPMVGLGVVIPVVLALLFIH 209
gi 81726457  141 IALLNDLHKGRNSGDVWKWFIDITALLMVFFVLTGVCLLLPKKKTFRTSLQWMSFGSLLSLVIYFVAVP 209
gi 123589124 136 LSLIGDLHKGRHSGEAWSWVIDISAVLMILFAITGMIILFQNRKKRLAGIWITVLGIATPVVIYLCWVP 204
gi 123276360 145 LAVMNDLHKGRHTGGAWSWVIDLSALLMVLFAITGFILVFQNKRQRVNALWVTALGVATPVIIYFVWVP 213
gi 81355511  180 IGFIDDLHRGGHVGTGWPLFIDVFAIACIIFSISGIWLLQIHARKRPSTWPLVALGLAVPIVIILVALH 248
gi 81659320  150 ISYFNDLHKGRNTGAAWKWFLDLFAIATLVFCFTGLLLLVEHARRRKMTWPLVGLGLFLPFLLAVLLIH 218
gi 501464689 131 VSYFNDLHKGRNTGLVWFWFLDVFALACIIFCVTGLVLLQRHAGSRPSTWPMVGLGLVLPWVLILLFIH 199
gi 503843773 139 ISYLNDLHKGRNSGDAWFWFIDVFAVACIVFTLTGLFLLQIHARHRPSTWPLVGLGLLIPVVIAILFIH 207
gi 500156633 141 ISYLNDLHKGRHTGVAWSWFIDLFAVACLVFCLTGLFILKLHAANRPTTWPIVGLGLVIPLLLTLLFIH 209
gi 503333253 122 VAVMNDLHKGRDTGKTWGWVIDVSAVLLVLVSLSGFALIFFLYKRRTAGLVVAAVGAIVIVVMYRCFVP 190
gi 145569591 157 IAYFNDLHKGRHTGEAWSWFIDFFAVACVVFSLTGLLLLQRHAGNRPSTWPLVGLGLVIPLLLALLFIH 225
gi 499839309 155 ISYFNDLHKGRNTGHAWSWFIDIFALACLIFSVTGLFLLKLHAGGRMATWPLVGAGLVVPLLLAILFIH 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap