Conserved Protein Domain Family
DUF5003

?
pfam16394: DUF5003 
Domain of unknown function (DUF5003)
This small family of proteins is functionally uncharacterized. This family is found in bacteroides. Proteins in this family are typically between 500 and 650 amino acids in length.
Statistics
?
PSSM-Id: 318582
View PSSM: pfam16394
Aligned: 5 rows
Threshold Bit Score: 434.291
Threshold Setting Gi: 524515399
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445599  146 KIFDEEGVEINE---LKVGYQH------FSKFSVQANFRFAATNLPGWVELEGGSLVGPVNQKVSGGLKIIED-DNREKY 215
gi 524306880 133 KVYDAAGNDITEt-gITVGYNV------YNKFTVKSNFRFAVTNTPAWVDLEGGFLVGTPNKEVVGGVAFKENqGVSAKY 205
gi 524317743 136 KTSENEEIDVTKt-gLTVGYKNiagqpiYNKFYVKSNYRFAVTNTPAWVDIEGGFMVGTPNKEAEGGLAFKENaGLSAKY 214
gi 524515399 143 KIYDMEGNEIHE---IEVGYNN------YKPFQIKANFRFAATNRPEWLEIAGNAIVGTANEMTKGEVKVIEN-SQYVKY 212
gi 524327254 144 KIYDKEGNDITEngvLKVGYQE------YFCFDVEANFRFAATNLPGWVELEGGSLVGAVNKKVQGGLRIIEN-ESREKY 216
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445599  216 PVPASDKNVITFSDEEGKAFYSFNVSYDGMTPGVLEMTLP-SSNKYDWAVSLDGKTFTQSAGGVAGTGGSTTTLKNRVPF 294
gi 524306880 206 AIAKDGNYTITFTSEDGKAAVTVPVIYNGMTTSTMDVTYPtSSQWAVWNVSLDGKVFTQNGSSLNGGDTNDFTFYNFVPF 285
gi 524317743 215 AVAKDDNYTITFTSEDGKAAVTVPVIFDGMTADIMDITYPtSNQWAVWNVSMDGAVYTQNGSSLNNDATNAFTFNKFVPF 294
gi 524515399 213 V----QNGTLTFADEDGVMSYSFPLVYKGMDPKSIKILDS-NPTPWNWEVSLDGKTFTQTSGAGTGTSTTTSTYNKFVPY 287
gi 524327254 217 PVSASDENVITFSDEEGRSFYTIRLAYEGMTPGKMELKRP-SSYATDWVVSMDGKTFTQKST---GGSTGEVVVKKRMPF 292
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445599  295 TVKTLNDDYEVVFVEKgsNNN----DLYIMDASYne---wMRCEREG-GKATLIVDEYTPASY--EPaervgYVLVFSRA 364
gi 524306880 286 TLKTLGDAYQLVVFEK--EKD----GLREDVTGA------VKLQGEK-GDVKLTIDALSSGSR--EF-----LVYALPQG 345
gi 524317743 295 KLSTLNDAYQLVVFET--SDW----GLREDMVGA------VQLQGEK-GDMKLTVAPLASGSR--EF-----FVYALPQS 354
gi 524515399 288 TVQALNDEVVPVYIQKv-vEW----GMVQMKIGEedgvdwMRLEDDGkGNLRLKVDESSeer--------egYVLVLPKA 354
gi 524327254 293 TVKTLKDDFEIVFLSEgwDGNihlkGSMYDFFTYe----wVHCEKDE-GNLNLTVDDYIPNAMngDPdersgYVLAFSRA 367
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445599  365 QYEDIKDNLEATIi-D-----GED-LVYKYEQSNLVLQFTQKETKGGG-DEL-AITAVDGQTYNPIDCTSYTG--GDAD- 432
gi 524306880 346 VYADFENGLDEML--E-----NDYtSVKSDYDRYFLMDVVQKKANSSA-DDQsAAPTILKMNYLPVECKKDKSmyGSII- 416
gi 524317743 355 VFESLGNGTDDML--E-----EDFtTVKSDYDRYFLMNIVQKEKSNGG-AEV-QLPLVTSMGM-DMNCALTEN--EEFKm 422
gi 524515399 355 LYEEIKDELWENLi-EmdmetYEQdINYIYQNNNLLINFVQKEKKQETaQAF-KVTYFNGVSMQEVACSKVTD--PDII- 429
gi 524327254 368 EYEKIKDNLEEAIvvN-----GE--IDYKYEQNNLLIGFTQKEVKEEP-QNN--SFKIKKGGWEEVSPSKTTE--QSIL- 434
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|.
gi 81445599  433 --YFKS-EYGVTGIFeIKQPASVATVAKMPF----NWSNSV 466
gi 524306880 417 --SEAF-GYNGDEIY-VAQSEVGSSLTVNPNi--kDWDPTT 451
gi 524317743 423 yaEGLF-SYTGKDVF--EATVYGGYVCIYPQi--dGWNPTE 458
gi 524515399 430 --DLYS---GVSDIYtVEYPA--AAIEIDPLl--gDLEIDW 461
gi 524327254 435 --DFLQgNYMLDEVYsIS-ANAGDYYSIYPLlsesEWAGEA 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap