Conserved Protein Domain Family
DUF5007

?
pfam16398: DUF5007 
Domain of unknown function (DUF5007)
This small family of proteins is functionally uncharacterized. This family is found in Bacteroides and Sphingobacterium. The members in this family are around 350 residues in length.
Statistics
?
PSSM-Id: 318585
View PSSM: pfam16398
Aligned: 5 rows
Threshold Bit Score: 448.088
Threshold Setting Gi: 503431356
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445558    5 FSSGNSTLPLTFEISRIVRA-DGSPAPELTEYFPVKVWKTPYMGTEKSIEEIEAKREIEYRTLFQVKKHSGEFMMWSNAE 83
gi 502446800  53 FNTDNSTTPISFRILNVRYKrDGKAASDFDQQTDVLVWKSAYTGEEKSLAEIENKRAVERHSIFEIRPTSGDFVLWAEAI 132
gi 503431356  69 pNTDNSTKPLKFEIVNARYG-DGRPVTDIFQLRPTYVWTGEYTGIETSLEEIEAKRKIEERPLFEVQE-SGKFVLWGAST 146
gi 524327278  64 CNVGNSTLPLSFEIVDMMHN-DGTPAPELEEFYPVRVWKKPYLGTEKSIEEINAKRGIEYRRLFDVRKHSGEIIMWGEAN 142
gi 524127052  50 FSPGNSTQPLTFSITRVVRK-DGSEAPELTEEFPVRVWHTPYLGTETSLEEIEAKRGYENRSLLQVREHSGELILWANAL 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445558   84 SSFVQCAP-SDGYI------FDVLVKNSGGYKTFTDMQLIPVRESDYEPSI-YDPETGLVQg----------QDYVTPNS 145
gi 502446800 133 QSNMRHQP-DSGYL------FDVEATNSGGTNTYKDLSLMPMREQPYAPYE-YDAVTGIHR-----------ANFPNPND 193
gi 503431356 147 NELITPRPaDSSNLvqdrryFDLKITNVGGERIIRDFQLIPWRELPYEPNNdINRYTGGVApdpkdprnpnkRDYIRPSL 226
gi 524327278 143 SGILRCQP-DSGYV------FNMEITNSGGHKTVRRMRLMPKREMDYEPSV-YDSETGLAI-----------AEYVSPET 203
gi 524127052 129 SSFVKCAP-DSGYV------FDIRVTNSGGWKDYTGLRLIPYRERDYEPTN-MDETTGIVT-----------EDYVHPTS 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445558  146 LT---LFQTESGDYMF----------PEDVHIYFrenqDNDDDVKSLTFRFYGPDYTPISPSSFNQTDWANLIH-GFNM- 210
gi 502446800 194 SSvfeLIYNHPGVYNMvdddtnldlkGDSVRVFF----NKKGNGNSLSFKFMDKDSLPIDPAKFNLTPWDSLMH-GFDK- 267
gi 503431356 227 TN---VIGAESNRNLVtn------ddQKDVVVYIr--pFEGGNGHNLRFSFWGPDSTAINPAKFNETRWNDLVH-GFNR- 293
gi 524327278 204 SR---MRYEPSGSSSFsys-----iePEDIHIYFrenkDKQDGATSLTISFYDPSWNVIDPRRFNETNWNGLFQaGFLKg 275
gi 524127052 190 VS---RMYKVGESSLFgl------mePEDINVFFrrdvENESKEYTLTFRFMTKDYQPISPRKFSGTDWGHLVH-GFDM- 258
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 81445558  211 EKTDEYVKYDVVYPMPLVEMKSKYTNKDGNRINVNFLYDRITASGYRMTSTMSFEFAIYKEAHWEIIVVFTAGaPLFED 289
gi 502446800 268 KITTTEVTYQVAYPIPAMRFRTRYTNGDGSQAYVKFSFTRVAFGNIRQTGVLDLNFNIYQKGDWEIIFYFRNN-PRFRD 345
gi 503431356 294 VNTTEYVQYDVAYPIPLTTVATKYTT--GGSAKLEFAYSRLGFNNVRTTAYIGLNFKIFREGDWEIIFHFRRElPKFED 370
gi 524327278 276 QVGPEKVVYDMAYPLPLFVEQTKYTDSKGEKASVKFTTSWLTKYGYRNNAYFVFDFAIYKEAHWEMLVHFAKGmPQL-G 353
gi 524127052 259 EMTDEYVRYKVAYPIPLNDIPTEYTNKDGDKAHVVFRYDRLMNGTQRVASSMSFDFSIYKEGHWEIIFVFSGGdPEFRD 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap