Conserved Protein Domain Family
DUF5016

?
pfam16408: DUF5016 
Domain of unknown function (DUF5016)
This family of proteins is functionally uncharacterized. This family is found in various Bacteroides species. Proteins in this family are around 660 amino acids in length.
Statistics
?
PSSM-Id: 318592
View PSSM: pfam16408
Aligned: 3 rows
Threshold Bit Score: 187.451
Threshold Setting Gi: 81443525
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443525    1 MKKSIYITLALAGILSMNSCNDD--EFLPGN--PSMEIKAENADALFGDSLPFTIKASDvDVPLSTLKAQLFYGEEQVSE 76
gi 505358771   1 MKTLKYIALSLLVAASTTACKDDp-ELLTTDvgPEMTVVSADASGVYGGKVDFEVTMTD-RYALSTLKAQVFFDDEMVAE 78
gi 524529068   2 nKILKTMALLAVPATVAVSCKDDgmDVKFTDkgPEMTIESCATEAFMGDSVRFSIKLND-EFPLSTLKAKLLFDGTSVSD 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 81443525   77 TVIRTKTSGSdYTGKIYIPYYANIPNGKATLKYILQNIHFTTTE 120
gi 505358771  79 EVIRTKSDGT-YTGAVTLPFYKNIPDGEATLRFVGQNVRFGTTT 121
gi 524529068  81 LTIRTKTYGT-YDAAIFVPLLKDIPDGTAEITFTAQNTGLGITE 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap