4B89,4CT4


Conserved Protein Domain Family
CNOT1_CAF1_bind

?
pfam16415: CNOT1_CAF1_bind 
Click on image for an interactive view with Cn3D
CCR4-NOT transcription complex subunit 1 CAF1-binding domain
This is the CAF1-binding domain of CCR4-NOT transcription complex. It adopts a MIF4G (middle portion of eIF4G) fold.
Statistics
?
PSSM-Id: 318598
View PSSM: pfam16415
Aligned: 95 rows
Threshold Bit Score: 218.508
Threshold Setting Gi: 121973903
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4B89_A         26 NQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMV 105
gi 74606700   802 TQEVPPREVTEAILFNVNNITMSNFDTKIVELKALLEEKYYQWFSNYLVNQRSKTEPNYHPLYAKMLKIIDSKTLHAYML 881
gi 156847432  779 NQVIPPNATKDKIYFTMNNLTEENIDIEIKKIAVEVNENYFKWFAQYLLFERVLKEPNNQKIYSLITTKINT-DIFGYMQ 857
gi 156838732  454 AQENPPKEIVEKILFVVNNMTMENFDDKIPDLKAVLSPAYSSWFSQYLINQRVKTETNYHPLYSKIITSIGYDLLHDFMI 533
gi 367004292  634 PQENPSKDTIEKILFLVNNMTEENFDSKIDNIKSLLQPAYSSWFSHYLVTQRAITEPNYHSLYSKIITFIDSDVLYEYML 713
gi 365990019  788 vQESPPKDFVEKVLFVVNNITIDNFDTKINDLKPILTPNYFSWFSTYLVNQRAKTEPNYHTLYSKVLVGINSEALHAYML 867
gi 367009660  778 LQENPPKEITEKVLFVVNNITMDNFDVKIIDLKTVLTPNYFSWFSNYLVNQRAKTEPNYHKLYSRILTSIKSDLLHEYMV 857
gi 186703650  149 QQEAPPKEIMEKVLFVVNNITMDNFDSKISDLGPVLIPNYFSWFSNYLVNQRAKTEPNYHKLYSRLLTALGSNLLHEYMI 228
gi 444320858  789 MQQNPPKEVTEKVLFVVNNMTLDNFDSKVPELQLILGPNYFSWFSNYLVNQRAKTEPNNHKLYAKIIVYLDSDLLHEFMV 868
gi 363754083  774 PQENPPREVTEKVLFVVNNIIMDNIKEKINDLNAVLEEKYYAWFSNYLVNQRAKIEPNYHKLYAELLTSVDSKLLHKFML 853
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4B89_A        106 NVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESK 185
gi 74606700   882 NFTYKQLFIMLSTKELGQTEKTHMKNLSSWLGSITLSLDIPIKHKHIAFRELLLDAHKNDRLTVVIPFVARIIMQSKDSK 961
gi 156847432  858 YFTLKLLHNLISTKDIEKIDKSILKNASLWLGKITLGNNIPLDNPRFSIFRIILDGYTSNRLEIVIPFVTKIMASTADSI 937
gi 156838732  534 NVTLKQLLFLISTKDIHGIDRNILKSLSSWLGRITLGLDKPIIHKNIAFRELLLDAYKQNRLEIIIPFVCRVLMNTEDSR 613
gi 367004292  714 NTTLKQLLLLISTKEVSSIDKNALKSLSSWLGRITLGVDKPIRHKNIAIRELLLDAHKNNRLEIIVPFVCKIIANVIDSK 793
gi 365990019  868 NDTLKQLYIILATRDIQLIDKNHLKNLSSWLGHITLAIDRPLKHQNIAIRELLLDAYSEKRLEVVIPFICRMLQLASESK 947
gi 367009660  858 AVTCKQLYIFLSTKDAQLIDKNHLKNMAMWLGSITLSLDRPIRHRNIAFRELLLEAYMEKRLNVVVPFVAKVLQNAADSK 937
gi 186703650  229 SVTLKQLFVMLATKDIQAIDKNHLKNLSSWLGSITLAVDRPVKHKNIAFREMLLDAYHTKRLEVVVPFVAKILQNASESK 308
gi 444320858  869 NTTYRQLFIILATKDISSIDKNHLRNLSSWLGCITLGINKPILHKHVAMRELLLESYHEKRLDLIVPFVTKVLQNAADSK 948
gi 363754083  854 NSTYKQLYFLLSTKDVSSNDKNHLKNLGAWLGHMTLAVDKPIRHRNIAFRELLLDAHKQGRLDVVVPFVTKVLQQAAESK 933
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
4B89_A        186 IFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINTPEVIETL 247
gi 74606700   962 VFCPPNPWTMGILKLLLELNQKTDWPLSLSFEVEVLFKHLNLQFDDISPSNYLDIPDAAEYL 1023
gi 156847432  938 IFKFPNPWTLKILQLLKEMHQRSELSLTLSFEIEILFKALGLDLEDIGNSEYLIEHCKLKEs 999
gi 156838732  614 VFSPPNSWTIGILKLLIEMNNKANWKLSLTFEVEVLFKTLKLPLDVYPPSNFLETEDVIEEL 675
gi 367004292  794 IFAPPNAWTMGILMLLAELNKKANWKLSLTFEVEVLFKLLSISLAEIEESHYLENIDIVEEL 855
gi 365990019  948 IFRPPNPWTVGILKVLLELNEKANWKLSLTFEVEVLMKSFKLGMKAIDPSNFIGQPNIIDKL 1009
gi 367009660  938 VFRPPNPWTVGIVRLLLELNNKANWKLSLTFEVEVLLKSLNIDPKSITPTDMIGANNAVDEL 999
gi 186703650  309 VFRPPNPWTLGILKVLVELNAKADWKLSLTFEVEVLLKAFNLKPGSVQPSEFLNVGDITEEL 370
gi 444320858  949 IFKPPNPWTVGILKILLELNKKANWKLSLTFEVEVLMKTFKLPMDSIEPTNYLNVPDIVDEL 1010
gi 363754083  934 VFKPPSPWIVGILRVLLELNEKANWKLSLTFEVEVLFKALNLKLAELKPTNFMEVPEVTEYL 995
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap