3MLP


Conserved Protein Domain Family
COE1_HLH

?
pfam16423: COE1_HLH 
Click on image for an interactive view with Cn3D
Transcription factor COE1 helix-loop-helix domain
This is the helix-loop-helix domain of transcription factor COE1. It is responsible for dimerization.
Statistics
?
PSSM-Id: 318604
View PSSM: pfam16423
Aligned: 8 rows
Threshold Bit Score: 95.9862
Threshold Setting Gi: 258504950
Created: 15-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
3MLP_A        317 LNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 360
gi 706108247    1 LNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 44
gi 675865206  378 LSEPTIDFGFQRLMKLVPRQPGDPERLSKEVILKRAADIAETAY 421
gi 321475253  313 LSEPTIDYGFHRLSKLVPRHPGDPEKLGKEIILKRAADLAEAVY 356
gi 118343701  190 LNEPTLDYGFQRLLKTVPRHPGDPERLPKEIILKRAADVMEAVI 233
gi 1084295171 119 MTDPTIEYGFQRLCKIIPRHPGDPERLPREIILKRAADLAEALY 162
gi 258504950  350 LTEPSIEYGFQRLQKLLPKYPGDPDRLPKDLILKRAAELAEALY 393
gi 1005940752 332 INEPTIDQGFQRLAKLVPRHPGDLDKLPKEIILRRAADLAEVFY 375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap