Conserved Protein Domain Family
DUF5023

?
pfam16426: DUF5023 
Domain of unknown function (DUF5023)
This family consists of several uncharacterized proteins around 300 residues in length and is mainly found in various Eubacterium species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318606
View PSSM: pfam16426
Aligned: 2 rows
Threshold Bit Score: 394.546
Threshold Setting Gi: 932941033
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291531919  32 SMNAGKPQAAVAKAKSFYFGSQRILIQYRADSPELQTGYLSYKKGAMTYTINTGDYMYICAKAEKNNGFTELKLAKLSAP 111
gi 932941033  36 SMNAGKPKAAVAKAKSFYFGSQRILIQYRADSPELQTGYLSYKKDAMTYTINTGDYMYICAKAEKNNGFTELKLAKLSAP 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291531919 112 ADGTAANPATGYTQFQFAAEITASSTDHSLLDKLNTFSTDDDEGYYYALVDDQCKVIMTYWCETFIDDISKSTDTASTYS 191
gi 932941033 116 ADGTAANPATGYTQFQFAAEITASSTDHSLLDKLNTFSTDDDEGYYYALVDDQCKVIMTYWCETFIDDISKSTDTASTYS 195
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 291531919 192 KTTIFPTDNYYVDGYLFGAYPERYSMLGYTMFSEVDLPADPSASTTASATP 242
gi 932941033 196 KTTIFPTDNYYVDGYLFGAYPERYSMLGYTMFSEVDLPADPSASTTASATP 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap