Conserved Protein Domain Family
DUF5041

?
pfam16444: DUF5041 
Domain of unknown function (DUF5041)
This family consists of several uncharacterized proteins around 230 residues in length and is mainly found in various Bacteroidales species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318613
View PSSM: pfam16444
Aligned: 5 rows
Threshold Bit Score: 291.661
Threshold Setting Gi: 524258952
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 524339523  36 DVVDVLEMNGISIHRFDLRPLLKT--HYNVSFYVDEYRHAEKQGRVHSFMFGPNIMSVEVYPEEQWEAVRQEHHLAPNES 113
gi 524204442  29 DIYNVLEAMDIHMFRFELKEFLNK--VYTVTVYMDEYENGKSPKQVHNIRLGKNIQSLNAVPEEHRQAFREIKHIPEGKN 106
gi 524231012  31 DFRSLLEAAGYEAFGFDLSELLEGpgRYDMTVYIKEYESGVEI-RSREFPCGPNKLLVSDFPEKVRGEILPGEMADPQAG 109
gi 524258952  35 DIINVLDRMGIHIAHFDLSELDKK--EYNINFYIDEYKTGKKIDRIANFKIGRNRKDLPKKADEREAFIKSRNLNVSKKA 112
gi 524125009  35 DVLNVLEDMDIYIHRFDVSQFLDA--TYHVEIYVEEYKNNQKTGKVHHFDLGKNIRSLDEIPEEHRKGFRKEYQIPAGKK 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 524339523 114 EFDYIKSVTLTLQVK--DDSLATISVGSPGVGrMSKSSLKLYPVE---GYTqaiNYMYDSRPFRLESVTDGDTVEIPLVF 188
gi 524204442 107 EWENIKEMSIYLRKS--NDSTSVCTINVPGTM-KGGAPLKLQAIE---KYH---SYIYYPRLFKFQPIQDTDHLKIPLIL 177
gi 524231012 110 IYMLAKKLTIGFYPSg-TDSTAMLNFSIPEMR-EASQRLKLRSVTsssGYT---LTKYCTRPFGIDSFEAGKF--IPLVF 182
gi 524258952 113 KYWTLNQMSIYVIPE--SDSTVTITISCPRGA--ATQQVKIAALP---QNK---MPIYDFRTFEIAPVTE-KTQEIPLAI 181
gi 524125009 113 EWNNIKEISIYIRKEerTDTTAAIRISSPNVG-IQGFPFTLYPAD---GKK---FISYHTRPFAARAVQTADEMKIPLLL 185
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 524339523 189 FGSWWYDKRSNFIRFCGESEIDPQLQSQIVKDVPHSYVIGMRL 231
gi 524204442 178 YGSAWLDKQHDIIRFCGEREIDPEMKAEILKDIPHYFVIGIEL 220
gi 524231012 183 YGSMWFDAEHNLFRFCGENEIAPDLSGEIVGNIPHFYVIGIEF 225
gi 524258952 182 YNSFFFDEKHNISRSC-YGKITAEMSEDIFDILPHYYVIGITL 223
gi 524125009 186 YGSVWAEPGTTFFRFCGENEIGPEMKAEILTHIPHHYVIGLQL 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap