Conserved Protein Domain Family
DUF5044

?
pfam16447: DUF5044 
Domain of unknown function (DUF5044)
This family consists of several uncharacterized proteins around 220 residues in length and is mainly found in various Clostridiales species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318614
View PSSM: pfam16447
Aligned: 3 rows
Threshold Bit Score: 247.94
Threshold Setting Gi: 493618641
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 494756717  36 PFLTARGALAATQERYAFGPGEVIARFSPq--QEGMPPl-RYYIVRDGDWFAWCSVEGDGLFWRP-GALTAACPDGEAPL 111
gi 496552784  35 PYFTRSQALWALQKANFFEGGRVVAWSSP---PEDRDT--AYAVLRWDGWYAVGTLRRAGPFWEP-VRFNAVQPDDALPI 108
gi 493618641  36 PIPTIGAALRAAQQEILFGPGEIVAEFTRdelPEDAPDfdRAYVLQWEGRYALFTFSYCDLSWHQwARPVVLEPSPNLPL 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 494756717 112 AILASpTFGGTSPELVVVSSDPDIAAVELDYLVKSAIIDTVVyVHVEMARQEPLEdSCFYFSlEDAYSRLFYETPSTVFR 191
gi 496552784 109 TLLFE-DAGMAHSFLCVLSSDPQIVTMELDYVAGFSETSSSP-QQLRTLRREAVE-HCFLFP-CDGSAWVPVDDPFQSIR 184
gi 493618641 116 TA-----AAGSFPKCVLIYSQTDSIT-RVEAVHPCLDYERRDvQPLTTSSALALDnQLFFLPlSQSFDSSSV--VLDAVQ 187
                        170       180
                 ....*....|....*....|...
gi 494756717 192 VRYYDADGKLLYESPYPARWLEY 214
gi 496552784 185 LRGYDTAGNLVYESPVPSLWANY 207
gi 493618641 188 LRGYDASGALVYESPVPGTWAEg 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap