3JCL,4H14,5I08


Conserved Protein Domain Family
Spike_NTD

?
pfam16451: Spike_NTD 
Click on image for an interactive view with Cn3D
Spike glycoprotein N-terminal domain
The N-terminal domain of the coronavirus spike glycoprotein functions as a receptor binding domain. It binds carcinoembryonic antigen-related cell adhesion molecule 1.
Statistics
?
PSSM-Id: 318618
View PSSM: pfam16451
Aligned: 8 rows
Threshold Bit Score: 476.277
Threshold Setting Gi: 410563113
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JCL_A          2 IGDFRCIQlVNSNGANVSAPSISTETVEVSQGLGTYYVLDRVYLNATLLLTGYYPVDGSKFRNLALRGTNSVSLSWFQPP 81
gi 123862264   15 IGDFNCTN-SFINDYNKTIPRISEDVVDVSLGLGTYYVLNRVYLNTTLLFTGYFPKSGANFRDLALKGSKYLSTLWYKPP 93
gi 81965275    16 IGDFRCINlVNTDTSNASAPSVSTEVVDVSKGIGTYYVLDRVYLNATLLLTGYYPVDGSNYRNLALTGTNTLSLNWYKPP 95
gi 81965273    16 IGDFRCIQlVNSNGANVSAPSISTETVDVSQGLGTYYVLDRVYLNATLLLTGYYPVDGSKFRNLALTGTNSVSLSWFQPP 95
gi 316998098   16 VGDVKCTT-IGVNDFNSGAPVISTETVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGANYRNLALKASYLLSTLWYKPP 94
gi 81968255    16 IGDLKCTT-VSINDVDTGVPSISTDTVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGSTYRNMALKGTLLLSTLWFKPP 94
4H14_A          2 IGDLKCTT-VSINDVDTGAPSISTDTVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGSTYRNMALKGTLLLSRLWFKPP 80
5I08_A          2 IGDFNCTN-SFINDYNKTIPRISEDVVDVSLGLGTYYVLNRVYLNTTLLFTGYFPKSGANFRDLALKGSIYLSTLWYKPP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JCL_A         82 YLNQFNDGIFAKVQNLKTSTPSGATAYFPTIVIGSLFGYTSYTVVIEPY--------NGVIMASVCQYTICQLPYTDCKP 153
gi 123862264   94 FLSDFNNGIFSKVKNTKLYVNNTLYSEFSTIVIGSVFVNTSYTIVVQPH--------NGILEITACQYTMCEYPHTVCKS 165
gi 81965275    96 FLSEFNDGIFAKVKNLKASLPKDSTSYFPTIVIGSNFVTTSYTVVLEPY--------NGIIMASICQYTICLLPYTDCKP 167
gi 81965273    96 YLSQFNDGIFAKVQNLKTSTPSGATAYFPTIVIGSLFGYTSYTVVIEPY--------NGVIMASVCQYTICQLPYTDCKP 167
gi 316998098   95 FLSEFNDGVFAKVKNTKVTKNGIVYSEFPTMVIGTTFVNTSYTVVVQPRttvvnsklQGLLEITICQYSMCEYPNTVCNS 174
gi 81968255    95 FLSDFTNGIFAKVKNTKVVKDGVMYSEFPAITIGSTFVNTSYSVVVQPHttnfdnklQGLLEISVCQYTMCEYPNTICNP 174
4H14_A         81 FLSDFINGIFAKVKNTKVIKKGVMYSEFPAITIGSTFVNTSYSVVVQPHttnldnklQGLLEISVCQYTMCEYPHTICHP 160
5I08_A         81 FLSDFNNGIFSKVKNTKLYVNNTLYSEFSTIVIGSVFVNTSYTIVVQPH--------NGILEITACQYTMCEYPHTVCKS 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JCL_A        154 NtnGNKLIGFWHTDVKPPICVLKRNFTLNVNADAFYFHFYQHGGTFYAYYADKPSATTFLFSVYIGDILTQYYVLPFICn 233
gi 123862264  166 K--GSIRNESWHIDSSEPLCLFKKNFTYNVSADWLYFHFYQERGVFYAYYADVGMPTTFLFSLYLGTILSHYYVMPLTCk 243
gi 81965275   168 NtgGNKLIGFWHIDLKSPVCILKRNFTFNVNADWLYFHFYQQGGTFYAYYADAGSATTFLFSLYIGDVLTQYFVLPYVCt 247
gi 81965273   168 NtnGNKLIGFWHTDVKPPICVLKRNFTLNVNADAFYFHFYQHGGTFYAYYADKPSATTFLFSVYIGDILTQYYVLPFICn 247
gi 316998098  175 Gi-GSPRKELWHYEKAVASCLYRRNFTYDVNSDWLYFHFYQQGGTFYAYYTDSGFITTFLFNIYLGTSLSHYYVMPLSC- 252
gi 81968255   175 Nl-GNRRVELWHWDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGTVLSHYYVMPLTC- 252
4H14_A        161 Kl-GNKRVELWHWDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGTVLSHYYVLPLTC- 238
5I08_A        153 K--GSIRNESWHIDSSEPLCLFKKNFTYNVSADWLYFHFYQERGVFYAYYADVGMPTTFLFSLYLGTILSHYYVMPLTCn 230
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
3JCL_A        234 p--taGSTFAPRYWVTPLVKRQYLFNFNQKGVITSAVDCASSYTS 276
gi 123862264  244 aissnTDNETLEYWVTPLSRRQYLLNFDEHGVITNAVDCSSSFLS 288
gi 81965275   248 p--ttTGVFSPQYWVTPLVKRQYLFNFNQKGTITSAVDCASSYTS 290
gi 81965273   248 p--taGSTFRPRYWVTPLVKRQYLFNFNQKGVITSAVDCASSYTS 290
gi 316998098  253 -----SGKLDLQYWVTPLTNRQFLLVFNQDGIIYNAVDCASDYMS 292
gi 81968255   253 -----NSALTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMS 292
4H14_A        239 -----SSAMTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMS 278
5I08_A        231 aissnTDNETLEYWVTPLSRRQYLLNFDEHGVITNAVDCSSSFLS 275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap