Conserved Protein Domain Family
Phage_TTP_12

?
pfam16461: Phage_TTP_12 
Lambda phage tail tube protein, TTP
This family represents the phage-tail-tube protein from a set of Siphoviridae from Gammaproteobacteria. Tail tube proteins polymerize with the assistance of the Tail-tip complex, a tape measure protein and two chaperones. Infectivity of host is delivered through the tube.
Statistics
?
PSSM-Id: 318626
View PSSM: pfam16461
Aligned: 2 rows
Threshold Bit Score: 328.31
Threshold Setting Gi: 81523242
Created: 16-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81523242   5 TIPNPLAPVKGANTTFWMYNSEGDPFASPLSDNNWLRLANVKDLQPGELTADAEDNNYLDDENADWKSTTQGQKSAGDTS 84
gi 81523242   5 TIPNPLAPVKGANTTFWMYNSEGDPFASPLSDNNWLRLANVKDLQPGELTADAEDNNYLDDENADWKSTTQGQKSAGDTS 84
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81523242  85 VTLAWKPGEDVQKKLIQLFTTGQKRGFRIKYPNGTVDVFRGWVSSLGKTVQSKDEIARTVKITSVGRPYMAEE 157
gi 81523242  85 VTLAWKPGEDVQKKLIQLFTTGQKRGFRIKYPNGTVDVFRGWVSSLGKTVQSKDEIARTVKITSVGRPYMAEE 157
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap