Conserved Protein Domain Family
Phage_TTP_13

?
pfam16463: Phage_TTP_13 
Phage tail tube protein family
This is a small family of Siphoviridae phage tail tube proteins. The tube protein polymerizes to form the shaft through which the infecting DNA passes into the host.
Statistics
?
PSSM-Id: 318628
View PSSM: pfam16463
Aligned: 2 rows
Threshold Bit Score: 283.834
Threshold Setting Gi: 502752831
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 502752831   9 VLPAGTLVKFGKPGDSVEQMKPLINCKALGATGLTGSFVDCTTLMDTNKQFISDMPEGPEKSLGFIDDPENSDFVSFLNA 88
gi 488371444  11 MLPAGTVVKWGLMGAAFSTFKPLINCKALGAMGMTGGFVDCTTLIDTQKQSISDLPDGPEKSLGFIDAPKNPHFAEFLNA 90
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 502752831  89 AEKRDTVQFYIALPNKRTATMVLALSGWEMNDINAPASEVIQITVKGKQNNLVWGIA 145
gi 488371444  91 AEQRQTVQFYVELPNQRTVLMLLALSGWQMNDISAPASEAIQITVQGKQNKIEWGTV 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap