Conserved Protein Domain Family
DUF5049

?
pfam16468: DUF5049 
Domain of unknown function (DUF5049)
This family consists of some uncharacterized proteins around 60 residues in length and is mainly found in various Lactobacillus and Selenomonas species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318630
View PSSM: pfam16468
Aligned: 13 rows
Threshold Bit Score: 85.4486
Threshold Setting Gi: 503371325
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 504037430  1 MTEQIRDQILKVRDSGLTNMFNTGAVQWIASQMGLTELVDYL-DgDNTREYAHFILTGE 58
gi 490534906  7 ITDKIYRQIMAIRDSGACNMFDLPRVQEEAYKMGFYELVVFL-N-EHKKEYAEFILTGK 63
gi 503251046  1 MDEKVREQIMAIRDTGKVNMLSVIEVQRLAFDSGYYELVLYI-E-EHRREYWHFIMTGE 57
gi 503371325  1 MDETVKAQLEQVRTTALTNMFDVAAVIRIAEHLGLDELAAYLaA-GNAGEYTRFILTGK 58
gi 524061125  1 MTEKIKEQILAVRATGRTNMFDTNMVQVIANEMKFYELVIFI-E-EHKGDYAKFILTGE 57
gi 524697501  1 MTEKIRQQIFAVRATGRTNMFDIHVVLRIAHEMQFYELVIFL-E-EHRSEYVRFILTGE 57
gi 503885952  1 MDSKVKEQILAVRETGLTNMFDTLAVQRIAHERNFFELVVFL-E-EHRDEYARFILTGE 57
gi 754046324  4 pkqQLIKQILAIRETGEANMFDTLMVQRMAYERGYFELVTFI-E-EYKKDYCHFILTGE 60
gi 547615713  1 MDKKVKEQILAIRDTGLTNMFDVNTVQRLAYERDFYELVLYL-E-DHRKEYVNFILTGE 57
gi 763156791  1 MNQTIKKQILAIRDSGETNMFDIPIVTSIALREGYSKLVDYL-E-KDKEAYVHFILTGE 57
gi 167593718  5 MTEKIREQILSIRASGVTNMFDVPRVRHEAYVRGFHELVVYL-E-EHRAEYCRFILTGE 61
gi 503609427  1 MNENIRMQILAIRESGVTNMFDIPRVTQEAYSRDFHELVNYL-N-DHKTEYARFILTGE 57
gi 763158028  1 MNEIIKEQILSIRKSGVTNMFDVNRVQYEANERGFYELVVYL-I-DHKAEYAHFIMTGE 57
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap