Conserved Protein Domain Family
DUF5053

?
pfam16476: DUF5053 
Domain of unknown function (DUF5053)
This family consists of C-terminal of uncharacterized proteins around 100 residues in length and is mainly found in various Prevotella species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318638
View PSSM: pfam16476
Aligned: 23 rows
Threshold Bit Score: 76.5002
Threshold Setting Gi: 524669984
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 81315155   74 GDLGDVISLSYIAQHYFQKDRSWLAQRINGNIVNGKPSAFTDDELELFKFALNDIKNKL 132
gi 81842079   74 KDIVPAITWSYIAEEYFNKSRSWFSQRMNGYHVNNKVATFTDDEIDLLSDSLLDLSERI 132
gi 503384802  70 eDTYQLIPMSYIAKHYFGKSASWLYQRINGNKVGGRQYTLNEEQKATFNRALQDIAKRI 128
gi 644295487  63 AEVSEIISLSYIAKTYFNKTKSWLSQRVNGHTVNGKAALFTSEEMKTLNFALKDVGKKI 121
gi 524326880  72 KEISEIVSLKYIAKNYFGKSASWLSQRINGSPVRGKIYCLKESELDILNSAIQDIGKKL 130
gi 524669985  24 sELEGLINKSALAQQYFGKSQSWFAQRVHGCVVGKKGMTFKEEEYHELAEAFRDIAKRL 82
gi 524483488  83 tedYKLLPLRYIAEVYFGKSAAWLSQRLNGSEVRGHVYTLSTEQKDIFNQAVQEIGKRI 141
gi 503382845  70 KSISDMISFKYIAETYFKKSKAWFSQRLNGNVVHGKVCRFTDEEMQTLRFALQDISKKI 128
gi 500650258  75 KEAVEILPLAYIARNYFGKSASWLYQRINGYKVRGKVYTLNHEEIGIFNRALKEIGEKI 133
gi 524357261  90 apyADIIPLGYIAKKYFGKSTAWLSQRINGTKVRGKVYTLSKEDLETFNFALQDISRKL 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap