Conserved Protein Domain Family
DUF5055

?
pfam16478: DUF5055 
Domain of unknown function (DUF5055)
This family consists of several uncharacterized proteins around 100 residues in length and is mainly found in butyrate-producing bacteriums. The function of this family is unknown.
Statistics
?
PSSM-Id: 318640
View PSSM: pfam16478
Aligned: 3 rows
Threshold Bit Score: 186.758
Threshold Setting Gi: 1046956196
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291561312    1 MAKQIVFTYEDKEYTLEFTRRTVKQMEDEGFVAQDIDRKPMTLLPALFAGAFKAHHRFEKQDVIDKIYAGMPHKDELIGK 80
gi 291563681    1 MAKQLKFTFKDKEYVLEFTRRTVTEMEKKGFVAAEVENKPMSTLPALFEGAFLAHHRFEKKEVINEIFSHMTNKEELIGK 80
gi 1046956196   1 MAKQLRFNFKEKDYTLEFTRKTVTEMEKKGFIASEVEDKPMSTLPALFEGAFLAHHRFEKKETINEIFSKMTNKEELIGK 80
                          90       100
                  ....*....|....*....|....*.
gi 291561312   81 LAEMYNDPIVTLMEEPdEKAVKNVSW 106
gi 291563681   81 LAEMYNEPIMALVEEP-EESEGNVSW 105
gi 1046956196  81 LAEMYNEPIIALVEEP-AESEGNLSW 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap