Conserved Protein Domain Family
DUF5058

?
pfam16481: DUF5058 
Domain of unknown function (DUF5058)
This family consists of uncharacterized proteins around 250 residues in length and is mainly found in various Firmicutes species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318641
View PSSM: pfam16481
Aligned: 62 rows
Threshold Bit Score: 165.791
Threshold Setting Gi: 524485903
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81748670   26 NTPVLWLCALGVFAIICVQTVLYIRAARVAAPAVGMPISELKQSFRAGAVASIGPSLAVVLVAIALLALFGTPAVLVRIG 105
gi 493826955   8 NSPLLYALVGAGIVYILIFCVITLRKAYRHGLEIGLTKDKLKTAITSSAIYSIVPSISIVIGLFSLAAVLGVPWSWFRLS 87
gi 524419230   9 tSPLLLIMVIIGLLYIVVFSLIYLKKAYNHCLELGITKETLKNVIKSSLVFSIVPSLSIVVGLFALISVLGTVWSWWRLS 88
gi 505821104   9 NSPVMFLIVLIPVVFVLAQALVYIHLGAKRIQELGMEKGTVRKVIVNSAIFSVVPSLPIVITLAALILVLGKYVPWLRLS 88
gi 524334824   8 ESSLLYVLVIASLVIIAAICVYYLIICIRKAKGMGISGEKISEIIKSTAIFSIVPSIAIAIGLVTLVIVIGIPYAWFRLS 87
gi 524657762  14 rDPMVFILYGIVLAFIVALSLYYMLSALKRAKQLGIESSKIKKVITTSATFSILPGLGIALGVVTLVGTLGIAFPAIRLS 93
gi 505823410   8 gHWLIYLMVGIGILFVACLAVVSMRKSWKRAIAKGYPREKLMTVVKSAVSATIIPSLAIVIGFFALVPILGVPWPWWRLS 87
gi 524193773   8 NSPLLYALVGAGIVYILIFCVITLRKAYRHGLEIGLTKDKLKTAITSSAIYSIVPSISIVIGLFSLAAVLGVPWSWFRLS 87
gi 524512141   8 NSPLMAVLCGLTILIVLLQPVIFMAAAFKRGKELNMTKEEMKEAARSSAIFSIIPSLPIIVSYLLLVPALGRYFPWLRLS 87
gi 503434277  12 NSSIVFILCAIVILIVSVQAILFIKNAYNRGLELGMTKKTLKRAMTNSAMLSVVPSLPIIVMMLALSVPLGKYFPWLRLS 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81748670  106 LIGSAQAEVGSASAAAMSMGAE---L---G-S---GSYTQQVFAVAFMVMSLSGAMWMLCALILTPILKRGGKTLATR-- 173
gi 493826955  88 VVGSVTYELMAADMVATGAGYE---S---I-AalnAAGDASIVGTVMFVMSICILGGIVGVLIFGKKVQTSLQKAKNT-- 158
gi 524419230  89 VIGSLSYESLISSSVASAIGFS---S---S-AemlENATGQQFGVVMILMSVGMLSGFFILLPLGKKLSMSVSKSDNS-- 159
gi 505821104  89 VIGSAMYESMCADMTIKAYGYTg--L---G-D---TSISTTVFASVVWVMCGAAVVWPLTNVIGLRFYDKRIKALQ-K-- 156
gi 524334824  88 VIGSVSYELMASNMALSALNLD---L---------ASADANAFGMIMWVMCIPITSTVLANIFVCKPMHLGTLRVGSG-- 153
gi 524657762  94 VVGSLQYETQMANGVAEGLYGSmeaM---I-A---HGITAQDFATMAMIMTIAICSGGVEVLFFYRLYQPKIGKLMAK-- 164
gi 505823410  88 VVGSVTYETMAADSAVKAAGLD---M---TkL---SLATAEDFVLVMFVMSIGIIGGLFFSPFASKSIQAGTMKLKVG-- 156
gi 524193773  88 VVGSVTYELMAADMVATGAGYE---SiaaL-N---AAGDASIVGTVMFVMSICILGGIVGVLIFGKKVQTSLQKAKNT-- 158
gi 524512141  88 VVGSAVYETMVANMAAEAFGLE---Si--T-A---GEIPVDVFVFILFVVTIGILGGNIFNVFFLKSYDKKVESLKSG-- 156
gi 503434277  92 IVGSAGYEGMAANIAAQSQGLT---Di--S-D---PNLTAEVFIIIMFVMTIGIIWGILFNILFMGKLDQVSQKAKEEsh 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81748670  174 SP-------VAMALIPAAALLGAFSALAVGEM---------P----K-----SSIHLILVVVSGGVMALC-LLLARNFNL 227
gi 493826955 159 HG-------ALGALLTGVLSLAIIEAFLPIQI---------M----K-----GPVYLAVVVTSCVIVVIH-MAVIKKFKI 212
gi 524419230 160 TN-------TWKYVLSGCFMLCLFAVYIPVLL---------I----G-----DTVQAAVMLTGLVIAVVL-GILAKKPKL 213
gi 505821104 157 TS-------EFIRPATTAMFIGLMAIMGVPRF---------L----NykspaGRLGIVVCSVSAIAVLLI-EYIAKKLKV 215
gi 524334824 154 DK-------KWGALSQTTFMTALLVVLIVPML---------F----G-----GLVGLFTFITSALIAVDV-SALAKKTGA 207
gi 524657762 165 TTggkkggvNIGDLIFQVSFIGMVIGYLAMSIetlaknvtfV----D-----GYYNFIAVLVAMGCMYVC-DVLINKANW 234
gi 505823410 157 DK-------RWGALGSSVFFLVILVVFVVPMF---------LdyskT-----GIVKLLTLVSSGLITVIL-NVVADKCKA 214
gi 524193773 159 HG-------ALGALMTGVLSLAIIEAFLPIQImk------------------gpVYLAVVVTSCVIVVIH-MAVIKKFKI 212
gi 524512141 157 NA-------ALVPVITTAMFLGMYGTMAAPHLtnf----------------sslPAVAAILVAGVTAIGVnKLAAGRKK- 212
gi 503434277 163 NT-------NIVALVSGALFTAMLITLSTPYVfnt----------------kniSSLVAFLAAGLTTLII-DFLAKRFGW 218
                        250
                 ....*....|....*.
gi 81748670  228 TWLREWALGFAIIISL 243
gi 493826955 213 LWLRNFVMADTLLLGM 228
gi 524419230 214 GWLNNFIMAFSMIGGM 229
gi 505821104 216 KTLSDFAFPLAMVLGM 231
gi 524334824 208 KWMNDFILAICLIGAM 223
gi 524657762 235 KWLDSFSTPVSMLIAM 250
gi 505823410 215 GWLRGFTLAISLLLAM 230
gi 524193773 213 LWLRNFVMADTLLLGM 228
gi 524512141 213 --LKEFAFPLSMLVGM 226
gi 503434277 219 TSLKDYSLPVALIVGM 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap