2M76


Conserved Protein Domain Family
CPT_N

?
pfam16484: CPT_N 
Click on image for an interactive view with Cn3D
Carnitine O-palmitoyltransferase N-terminus
This domain is found at the N-terminus of carnitine O-palmitoyltransferases. It functions as a regulatory domain and is linked to the catalytic domain (pfam00755) via two transmembrane regions.
Statistics
?
PSSM-Id: 318644
View PSSM: pfam16484
Aligned: 29 rows
Threshold Bit Score: 61.8634
Threshold Setting Gi: 57013808
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
2M76_A          1 MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRF 46
gi 339254486    1 MAEAHSAVAFGFTVSHDGVSLNYDKELLKIVYQSISRSYKRRVARF 46
gi 699250383    1 MAEAHAAVAFSFSVTQEGLNVQISHEAMQAVYFSGVRSWRKRLTRF 46
gi 1005949051   1 MAEAHQAVAFSFQITHEGVHINYDTEILNIVWTSGVRSYRKRFTRs 46
gi 321462616    1 MAEGHQAVAFSFAITHEGLDVNFDFEVIRLIARSAVRSWRKRGLRF 46
gi 341893793    1 MAEARSAAALSFAVTHDGVSVSYDQELLRDIWHGISRSYKRRTGRF 46
gi 802741412    1 MAEAHSAAALSFSLTHDGVSVSYDQELLRDFWHGYVRGIKRRMGRF 46
gi 312078177    7 MAEAHSIAALSVSLTHDGISISYDQELLNEIMHSFFRAYKKRVARF 52
gi 156341960    1 MAEARLAVALQFQVTDEGIVLHFDSSAFKFVFRAITKTVKRKLKEF 46
gi 74920962     1 MAEAHSAVAFSFSITHEGWDINYDREVLDLVWQSGVRSWKKRLARF 46
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap