Conserved Protein Domain Family
Na_Ca_ex_C

?
pfam16494: Na_Ca_ex_C 
C-terminal extension of sodium/calcium exchanger domain
Na_Ca_ex_C is a region of the higher eukaryote sodium/calcium exchanger domain that extends toward the C-terminal, and is cytoplasmic.
Statistics
?
PSSM-Id: 318654
View PSSM: pfam16494
Aligned: 32 rows
Threshold Bit Score: 148.196
Threshold Setting Gi: 802666152
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123888535  145 RRLLFYKYMSKRYRADK--RTGV----VVETEG------EMTPK--G----------ME---------M------MM--- 182
gi 459179942  257 RRLLVYKYMYKRYRMRK--NKNM----IVETEG------SALDE--DnrqdgttvlnMD---------S------LE--- 304
gi 241674117  239 RRLLIYKYLSKKYRVNK---RGV----IVGGEG------E------D----------VE---------MgqakdrLV--- 277
gi 1032763419 209 RRLLIYKYLHKGYRMNK---RGV----IVETEA------GDSDG--G----------VE---------L------EIktq 248
gi 156400136  240 RRLLFYRALRGKRRKQK--RGGVs---VIQT-G------DFDVI--G----------VR---------I------KQ--- 277
gi 802666152  132 ikIIQNKFLPKRYRRS---SHGL-----IATEGeemkmlESN----G----------VH---------L----------- 169
gi 332017456  209 RRLLIYKYLHKGYRMN---KRGV----IVQAE--------AGDSemG----------VEleikpqqdgFhgmvdrLA--- 260
gi 780180630  248 KRIFFYRFLRKKYTAErvvRRGSnlqnAMEMGEnemhenHLNHGmdG----------VE---------FkgkrykDL--- 305
gi 688555970  244 RRLLFYKYLNKRYRTDk--RHGI----IVEMEG------ELAPR--G----------ID---------A------IM--- 281
gi 992225936  233 RRLLFYKYMNRSYRAKk--RNGI----IVETEG------ELSPK--G----------ID---------I------IM--- 270
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123888535  183 -DG----------KFPLRAGdigigtqehyqdgtghttgtmatlpnsnS---TT--VYMDGVKDLDESRKE-VIRILKDL 245
gi 459179942  305 -DG----------KANTDDDq---------------------------V---GN--VMDPLIVDPESNRKA-MIRIMREL 340
gi 241674117  278 -DG----------VLGGPTVk--------------------------fI---GG--EQSPEAKAFEENRIE-YVQILREL 314
gi 1032763419 249 hEQ----------SNGMLDK----------------------------Y---VD--ADSAESREFEQTRRD-YIKTLKEL 284
gi 156400136  278 -DGltpeegaeenGYPLQTV----------------------------EgaeDL--EDDYALHDLTEERKDkAIQVLRDI 326
gi 802666152  170 ------------------E-------------------------------------HGDPAIKAFEDHRQE-FIELMREI 193
gi 332017456  261 -DG------------------------------------------------------DSPEAREFEQTRRD-YINTLKEL 284
gi 780180630  306 -DG----------D--------------------------------------------VSDIKDLEDSRKE-TIRLLREL 329
gi 688555970  282 -GE----------KYQNNTt-----------------------------------sVDMEKNKEPEQDREE-VIRILKDL 314
gi 992225936  271 -DG----------KYQGNPnss-----------------------tsnS---TSniINIESNKEPEQDREE-VIRMLRDL 312
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 123888535  246 KQKYPDKELDQLVELANYYALLHQQKSRAFYRVQATRMMIGAGNVLKKH-A 295
gi 459179942  341 RKTHPDADMAELAKMASSEALSNQPKSRAFYRIQATRKMTGAGNILNKG-K 390
gi 241674117  315 RHKHPDSSLEELESMARDEILSRCPKSRAFYRIQATRKLMGAGNLMRRK-E 364
gi 1032763419 285 RKKYPQLSLEQLEVMAHEEVLGKGPKSRAFYRVQATRKMVGAGNLSRKI-S 334
gi 156400136  327 KAKYPNADRETVERLLEQENLRLQPKSRAFYRIEATRKMVGSGNIVKMK-H 376
gi 802666152  194 RKKNPHIAPADLQKQAEYEMISRGPKSRAFYRVQATRRLIGGGDIVKKR-L 243
gi 332017456  285 RKKYPTLALEQLEVMAHEEVLGKGPKSRAFYRVQATRKMVGAKAELQKA-E 334
gi 780180630  330 RQKHPDADLATLEQMANYESLNNQQKSRAFYRIQATRKMCGAGNILKKT-L 379
gi 688555970  315 REKHPDKDLDQLIEMANYASMQKQRKSRAFYRVQATRMMIGAGNILKKHaA 365
gi 992225936  313 RQKHPDKDLDQLIEMASYSTLQKQPKSRAFYRVQATRMMIGAGNVLKKHaA 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap