Conserved Protein Domain Family
SWIRM-assoc_2

?
pfam16496: SWIRM-assoc_2 
SWIRM-associated domain at the N-terminal
Much of the higher eukaryote SWI/SNF complex subunit SMARCC2 proteins is of low-complexity and or disordered. However, there are several short regions that are quite highly conserved. This is one of these regions. The function of the individual regions is not known.
Statistics
?
PSSM-Id: 318656
View PSSM: pfam16496
Aligned: 26 rows
Threshold Bit Score: 549.634
Threshold Setting Gi: 357613416
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122068748     6 PKKDGSPNAEFFTAPESLQGFETVRQWLQKNFKKYLA--PDPPTKESLAQLIIQFVQYQETKLGKNAQDPPTTRLPMRCF 83
gi 242021599   519 siiDGGPNIKFFESPETLSLFDGIKSWLQKNCKKV----TDPPTAKSLSTLVIQLIQFQEDNFGKNVSKPPLTRLPMKCF 594
gi 157105746     6 PKKDGSPNAEFFTAPESLQGFETVRQWLQKNFKKYLA--PDPPTKESLAQLIIQFVQYQETKLGKNAQDPPTTRLPMRCF 83
gi 328721285     6 PKKDGSPNVKFFESPETLNMLEGVRTWLMKNHKKYLQ--ADPPTNKTLAALVLQLIQFQEDNLGKNVSKPPLTRLPMRCF 83
gi 189240839     6 PKKDGGPNVKYFESPETLAALELVRQWLQKNGKKYFQ--AEPVTNKSLSMLVLQLMQFQEDFLGKNVQKPPMIRIPVRYF 83
gi 749773711     6 PKKDGGPNAKFFESPDILAQLDSVKQWLLKNCKKYVQ--TDPPNNKSLATLLVQLLQFQEDNLGKNVSKPPMTRLPMKCF 83
gi 1032011427    6 PKKDGGPNTKFFESQEILTQLDAVKQWLLKNCKKYVQ--TDPPTNKSLATLIVQLLQFQEDNLGKNVSKPPMTRLPMKCF 83
gi 645033996     6 PKKDGGPNLKFFDSSEVLNQLDSVKQWMLKNAKKYIQ--TDPPTNKSLSTLVVQILQFQEDSLGKNVTRPQMTRIPMKCF 83
gi 1013926480    6 PKKDGSPNIDFFQSPETLQGFESIRQWLQKNCKKYLAhsSEPITKESLAQLLIHFLQYVEAKLGKNSADPPATRIPMRCF 85
gi 357613416     6 PKKDGGPNIEFFQSPESLAQFDQIRVWLQKNCKKHVQ--TDPPTKEGLAQLVIQLIQYQENKLGKNATDPPFMRLPMKVF 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122068748    84 MDFKPGGALCHILATMYRYKAEQRWRKFDFTvnkNPMRKDPIIQMLLDMETALIEAECMRLPIVYVRPEVDKGTANRITD 163
gi 242021599   595 LDMKPGGALCHILATVFRFKSEQGWRRFDFQ---SPSRMDRNVEMFMQVEKALIQAKCLTMPNVFIKADVEKGLQSKIKD 671
gi 157105746    84 MDFKPGGALCHILATMYRYKAEQRWRKFDFTvnkNPMRKDPIIQMLLDMETALIEAECMRLPIVYVRPEVDKGTANRITD 163
gi 328721285    84 LDFKPGGALCHLLATVYKFKVEQGWRRFDFQ---SPSRMDRSIEMFMNVEKALIHAKCLSMPVILIHPDVDKIVQNRIKD 160
gi 189240839    84 MDFKPGGALCHMLLAAYKFKSEHNWRRFEIPtgkSTGKLERVFEMLKCMEKVLVQNRFYTVPSVYIRPEIDKNLAAKLRE 163
gi 749773711    84 LDFKPGGGLCHILATAYRFKHEQGWRRFDFPggkSGSRTDRTVDMLMAAERALIQNRCMNIPSIYVRLEVDKNTAIKVKE 163
gi 1032011427   84 LDFKPGGGLCHILATAYRFKQEQGWRRFDFPvgkSGSRMDRTVEMLMAAERALVQNRCMIIPSVYVRPDVDKSTAAKVKE 163
gi 645033996    84 LDFKPGGGLCQILLTAFRFKQEQGWRRFDFPvgkSGPRTDRMIEMLVAIERALIQSRCLTVPCVFVRSDVDKPTAVKVKE 163
gi 1013926480   86 LDFKSGGGLCIIFSTMFRFRAEQRGKKFDFSigkNPTRKDPNIQLLIEIEQALVEADLYRIPYIYIRPEIEKGFEGKLRE 165
gi 357613416    84 MDMKAGGSLCTVLATMFRFKSEQRWRKFDFQvgkNPSRKDLNVQMMMEIESALLTAELLRSPCIYIRPDVDKATANKIKD 163
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122068748   164 IVTNHQGEMTLDEEEATHIIYPAVDPLPEDYARPTFR-RDKHVMIHWYYFPESYDTWVP-NTFDLP---DNVPDSpm--- 235
gi 242021599   672 IIKRHQGTVTDNEEEATHIIYPPCDPLDEEFARPSMK-RDKNVLVHWYYFPDSHDSWIQaDLPIDP---PDSPPV----- 742
gi 157105746   164 IVTNHQGEMTLDEEEATHIIYPAVDPLPEDYARPTFR-RDKHVMIHWYYFPESYDTWVPn-TFDLP---DNVPDS----- 233
gi 328721285   161 IIKRHQGTLTEIEQEATHVLFPVVDPLDEEYARPVYKnKERWIQMHWYYFPDSHDSWV---TTELP---VEPPEVlyg-s 233
gi 189240839   164 IVCRKMAQVAETEEMATHICYPPVDPVEEEYGRPVFK-RDKMVMMHWYYFPNSYDGWIn-LDISGEglsNDVPSP----- 236
gi 749773711   164 VVRRHQGTVVENEADATHIIYPPVDPMEEEYARPYMK-RERSILLHWYYFPDSYDSWT---TLDLP---WDYPEGtlmnt 236
gi 1032011427  164 AVRRHQGSISENETDATHIIYPPVDPMEEEYARPCMR-RERSVLLHWYYFPDSYDSWT---TLDLP---WDFPEGtltnt 236
gi 645033996   164 VVRRHQGTIAESEDDATHIIYPPADPLEEEYARPCFR-RERFVLLHWYYFPDSYDSWV---NIDLP---WDYPESalgni 236
gi 1013926480  166 ILDNRRVEIVSDEEDATHIVYPVVDPHPDEYARPIFK-RGGHVMLHWYYFPESYDSWVV-NNFDLP---DHIPENpe--- 237
gi 357613416   164 IIVNHQGEICEDEEDATHIIYPAVDPLEEEYARPVFR-RGNNVLVHWYYLPDSHDTWA---QADLP---VDVPETanwdc 236
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122068748   236 sPGDR---WRVSLSWVTDLDEYNEWMAEEDYEVDEDgrkkVHKLRLGVEDLMSG---VDDKIKKSkvvH-QKRKRSPSPP 308
gi 242021599   743 -HVGP---WRVAATWVLELEQYNEWMTEEDYEVDETgkkkVHKLRLSVDDLMASs-dPSSRKK-----P-NKRKKSPSPP 811
gi 157105746   234 -PMSPgdrWRVSLSWVTDLDEYNEWMAEEDYEVDEDgrkkVHKLRLGVEDLMSGv-dDKIKKSKv--vH-QKRKRSPSPP 308
gi 328721285   234 qHPTP---WRVTASWVLDLDTYNEWMNEEDYEVDETgkkkVHKLRLSVEDFMSNd-pSGGKKKPKr-kR-TP-----SPP 302
gi 189240839   237 -RTEA---WRVSCSWLLETDHYNEWMSEEDYEVNELgqkkIHPLRMSVEDVMNPs-nDDRSKKKQk-rK-R----SPSPP 305
gi 749773711   237 nSRSV---YKVSATWALDLDQYNEWMNEEDYEVDDSgqkrVHKYRLSVEDLMAqpshpPP-AKKP------KRKRSPSPP 306
gi 1032011427  237 nMKSV---YKVAATWALDLDQYNEWMNEEDYEIDENgqkkIHKYRLSVEDLMAqpshpPPSAKKP------KRKRSPSPS 307
gi 645033996   237 tTKST---YKVSATWALDLEQYNEWMNEEDYEVDDSgqkkVHKYRISVEDLMAtp--aPPSAKKQ------KRKRSPSPP 305
gi 1013926480  238 sPAER---WRVSASWIVDLEQYNEWMAEEDYEVDEQgkkkTHKQRISIDDIMSfg-deKKKPATSsggGkQKRRRSPSPA 313
gi 357613416   237 nRSEP---WRVSATWALDLTQYNEWMNEEDYELDQHgkkkVHKLRLSVDELMPga-esSGKSKKS------KRKRSPSPP 306
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122068748   309 LK-GGKRKSGRSp-----------AVFQKKPRADDEESEDMTKDMDDPQPETNLTE-VKA--------SS-S-Nsasg-- 363
gi 242021599   812 PKsVSKRKSTRGpp---------tPAVNNKKHRGEEESEDLTKDMEDPPSDTNIQE-VNC--------TK-P-G------ 865
gi 157105746   309 LK-GGKRKSGRSp-----------AVFQKKPRADDEESEDMTKDMDDPQPETNLTE-VKAsssnsasgPA-T-P------ 367
gi 328721285   303 SKp-NKRKSGRGg-----------sVMSVKKNKVDDDSDDLTRDLEDPISEPNISE-VNL--------NI-SqI------ 354
gi 189240839   306 SK-GGKRKSGRS------------PAIGKKQRPEDMETEDLTKDMEEPTPEPNIVE-VNS--------SMaN-Q------ 356
gi 749773711   307 PKl-GKRKSSRApsgiqsassassAAAPKKSR-GGEEEEDLTQGMEDPPAEPRIVEvVAT--------PT-N-Ppitgqs 374
gi 1032011427  308 PKp-GKRKSARApsgvqt-sssssLATPKKSRGGGEEEDDLTQGMEDPPAEPRIVEvVAT--------PT-N-Ppvtgqg 375
gi 645033996   306 PKl-GKRKSGRApagvqg-lsnvssTGPKKSRGGADEEEDLTQGMEDPPAEPRIVEvVAA--------NA-N-Sqnsgqn 373
gi 1013926480  314 TSaSTSKPGKRKr----------sPAVVHKKLRNDDDDEDLTRDLDDPPAEPNVQE-VHK--------AN-A-Alqstas 372
gi 357613416   307 PQkHGKRKS---------------RVAKRRDNDGDDEDDNASRDNTDVAPATDSERsTEA--------PV-S-Vpsagps 361
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122068748   364 ----------patpQPKr-------DPEMMPIKYATMTDLDE--EIDranaDrA-----GDDSQAGKTSDNS------NT 413
gi 242021599   866 --------------TSKk-------DSDLQPIKGGTMTDLEEg-DMDkv----------dESSQNTKTSDSNfiekekEK 913
gi 157105746   368 --------------QPKr-------DPEMMPIKYATMTDLDEe-IDRanadR-A-----GDDSQAGKTSDNS------NT 413
gi 328721285   355 --------------KTEkgsssskkDNDSQPIRSGTLMDLDE--DLDkgedN-K-----NYDNNAQDSTSCP------AS 406
gi 189240839   357 --------------NSKk-------DHELQPLKGGSVTDLEEn-EE-------R-----GEDSQNGKNSDSN------TQ 396
gi 749773711   375 natt-gnstlasagSKKq-------DSELQPLKSGNMADLDEpiEGDkgnsQsG------QDREERDTSKER------GE 434
gi 1032011427  376 nipt-sgntltttgSKKq-------DNELQPLKSGNMADLDEpmEGDkgssQsT------QDREERDASKER------GE 435
gi 645033996   374 ss----stggiisgSKKq-------DNELQPLKSGNMADLDEpaEGDksnsQtS------QDREERDTSKER------ND 430
gi 1013926480  373 ---------papggKSRg-------DNDMMPIKGGTMTDLDD--EMTggsaAqAmstgdGENSQTGKTSDNS------NT 428
gi 357613416   362 gaggsgsgggsgggGCSe-------VVQEAPATPAPAMDA--------------------HDDSQGKHSDSN------TQ 408
                          490       500
                   ....*....|....*....|....*....
gi 122068748   414 qe-fpH-----------GKDDLEDNVTEQ 430
gi 242021599   914 -----D-----------KESKQEDNVTEQ 926
gi 157105746   414 qe-fpH-----------GKDDLEDNVTEQ 430
gi 328721285   407 -----GvsstggalsiiKEEGPEDNATEQ 430
gi 189240839   397 ------------------DDGQEDNVTEQ 407
gi 749773711   435 g----G-----------KSDEPEDNVTEQ 448
gi 1032011427  436 g----N-----------KGDEPEDNVTEQ 449
gi 645033996   431 g----S-----------KSDEPEDNVTEQ 444
gi 1013926480  429 qefssS-----------AKEDMEDNVTEQ 446
gi 357613416   409 e----M-----------TKEELEDNVTDQ 422
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap