Conserved Protein Domain Family
DUF5059

?
pfam16502: DUF5059 
Domain of unknown function (DUF5059)
This domain is found fused to a copper-binding protein at the C-terminus, family Copper-bind, pfam00127. Its function is not known, and it is found in the Halobacteriaceae family in Archaea.
Statistics
?
PSSM-Id: 318661
View PSSM: pfam16502
Aligned: 7 rows
Threshold Bit Score: 610.677
Threshold Setting Gi: 445573566
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742   63 AVATEWNVYRARLHDAVALGRAGAPGAGATVAQNIFAQ-FEGASGEYGAHEQLESTSESAYEGFEDALGTVQ-SSLSEGN 140
gi 74568426   55 AVAAQWNVYRARLADAAALGAHGASDVGAQLAATTFEQdFENAGGEHGAHETLETTSESAYEGFEQAAIGVR-DALREGD 133
gi 492948881  63 avaaEWNAYRARLYDALALGVAGKTTAGAGVAQQTFKR-FEGASGEWGAHEQLEATNESNYESFEEHLGGLR-SALSEGS 140
gi 909644678  59 AVAAEWNAMRARLWDALAAGEAGETGAGAAIAGRTFDR-FEQASGEYNAHEMLEETDKSRYEGFEEALVELRtEGLEEND 137
gi 506244372  52 AASAQLNVYRARLFDAVALGRAGQTAAGASVAQSIFQR-FENATGEYGAHETLERTSESAYEGFESALGELR-STLEDGD 129
gi 445573566  56 AVAAEWNAMRARLYDTVALAAAGRLGTAARVTGDVFAR-FEQSSGEWGAHEQLEATNEQNYETFESHLGGAR-EAYAAGD 133
gi 909658563  59 AVAAEWNAMRARLWDALAAGEAGETGAGAAIAGRTFDR-FEQASGEYNAHEMLEETDKSRYEGFEEALVELRtEGLEEND 137
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  141 VSEAASAADKASGHLQTAQQAAAGQQATRVLDLLLLGSRASNAAMAGTLGAFEGAATIAEETMTAFEDALVYSKIEAADA 220
gi 74568426  134 SASAIEQAESAAANLRDAQQRLVGETAMHALDALAFADHAATARALAAAGQADAAAVAANTALSAFETAPAHEAMESAAT 213
gi 492948881 141 IDEARSMASQADQNLLAAQRGRVDGPVIDALSIALYGVRTRDVAMLAAADSTEAAATVGESVLEDFENASVHDAVEEASS 220
gi 909644678 138 IARGREETGIADKQLRGAQQTLVGEPTVQAFDLQAFGTTVADSVMLASAGAFDAAETVANDAFERFEGAAVHDAIGEADG 217
gi 506244372 130 TDAAAEAATTASDQLQIAQQALIGNDATRALDALLLGSRAANTRVLGEAGHFEAAATVATETTERFEDTLVHGALESADG 209
gi 445573566 134 AERGSDLAVQAADNLLAAQRGRVDAAVVDALEVLLFGARARDAGLLAAAGEVDAAAELANAVYEDFEDAPAHSSLESASG 213
gi 909658563 138 IARGREETGIADKQLRGAQQTLVGDPTVQAFDLQAFGTTVADSVMLASAGAFDAAETVANDAFERFEGAAVHDAIGEADG 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  221 ESYEAFENALAGIGSAAGSEDASGVTEQARAALDATVSGAYALVQpASVAGAGHLATMQARGWDAAAVVSGSGVGADYAH 300
gi 74568426  214 DAYESFESGLGDTLSAGQRGNADDANSAAATAVSAAVDGAYAIAD-TTGTEAGHIASLQSRAYDAAALNAMGGPSSDFGH 292
gi 492948881 221 ELYEAFEGGLKSAVSAAEKDDAEAAKTQAEKAFGAALSAGYELAP-EKVAGVAELAALQSVGFDAAAVANLSGPGTEYAH 299
gi 909644678 218 DVYEAFEAAMKSVATAAGNEDGESVRSSASDALEAAIDGGYALAPsESAAGAGEIAAYQARGWDAAALAGLGGPSTAFAH 297
gi 506244372 210 DAYEDFESGLASIQRAASEGDAEGVTDAVAAAQSAAVAGAYALGT-ESVAGTGHLAAMQSVGYDAAALAGLGGPSEALAH 288
gi 445573566 214 ELYETFEAAVEG---AADAGDAETIAASARTAADATVDASYELAP-EAVAGASHLALMQAVGFDAEVLAGLGGPGDEFAH 289
gi 909658563 218 DVYEAFEAAMKSVATAAGNEDGESVRSSASDALEAAIDGGYALAPsESAAGAGEIAAYQARGWDAAALAGLGGPSTAFAH 297
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  301 ATTLNTYRARVHDAGWLARAGETATAATMVEDVFAHFEGAAAHDALEEADSEAYEAF-E-SGLSDLSSAIENGntEGVAS 378
gi 74568426  293 AAVLSAYRARAQDAAWVADAGASDAAASMAISVLEDFEGAAAHEPLEETDHDAYEGF-E-GGVEALQEAITAG--SGVSD 368
gi 492948881 300 AASLTRYRARVYDVDWLAARGESDAAEKMAKDVFADFEGARAHEALEEADHDAYESF-E-GGLSDLRKAIKNGdaEARAS 377
gi 909644678 298 AAALTVYRARAHDAAWFFERGEHEAAARVVKNAFEHFEGARAHEALEEASEDAYHRF-EeDGLDALATAIENDdpAGVDT 376
gi 506244372 289 ATTLTTYRARIRDAAWLADADEGSTAGTVVGNVFADFEGARAHEALEEADHEAYEGF-E-SGLESLQSAVESG--EGVDD 364
gi 445573566 290 AAALSLYRARAADVPRLVAAGEADFAATVASDVFAHFEGARAHEALEEADHDAYEGF-E-GGLESLTEAAESGdgAAAEE 367
gi 909658563 298 AAALTVYRARAHDAAWFFERGEHEAAARVVKNAFEHFEGARAHEALEEASEDASHRFeE-DGLDALATAIENDdpAGVDP 376
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  379 AVETVDTNLVAGIEALAGGNAP-VLQSGFFKARFADARELYRQGQAGQAATLVSDLFARFEENQLDFHETLEETSEDLYH 457
gi 74568426  369 ALSQVDTNLVAGIKALTTDTEAvILETGFLRALLGDAREQYHRGNAERAAASVEAMFKRFERDELGAHETLESTSESLYE 448
gi 492948881 378 AVESIDAALLAGIEALVGGEASaVLESAFFRARFADANERYQRGENDVAAEIAQHLFERFEVNEAGFHETVEETSEDIYH 457
gi 909644678 377 AVDAIDDGLVTGIEALGTGSEAaLIEAGFFKARTEDAVERYRLGENAVAAELVSGLFETFEANEAGFHETLEETDESLYE 456
gi 506244372 365 ALATVDEHLRTGVATLAGDHAP-VLQAGFFRARLADARERYERGAPSVAASITQELFERFEADELGFHETLEEASEDLYH 443
gi 445573566 368 AVATVDENLLAGISALVGGEAAtVLEAAFFRARLGDARELVAVGETDRAAAVGESLFARFEENEANLHESVEEESEELYH 447
gi 909658563 377 AVDAIDDGLVTGIEALGTGSEAaLIEAGFFKARTEDAVERYRLGENAVAAELVSGLFETFEANEAGFHETLEETDESLYE 456
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  458 RFEEEHLVGLQSAYENGDDDAVGTHHDGVLAALLEFESAHSA-AVASGSGATYMAGLAFDAAATNALGNADRAASTAQGA 536
gi 74568426  449 TFEDEHVGALPAAMRNGNDDAVTTHLDGARSALAEFAAQIAPtARVAGGESVTITARAFDAAGVAALDDRTRAATVADDA 528
gi 492948881 458 RFEEEHLSALITAYKNGDDEAVTKHHEGVLSTLVEFESMIGt-AYSAPAESAFMAARAFDAAALATLGQSDRAASVIKSA 536
gi 909644678 457 TFEEEHLKGLIKACENGDDAAVDEHATGIRETLLEFETTIGSpAQVSAVESGYMTARVFDAGVLDALGASGRAETVVGET 536
gi 506244372 444 RFEEEHLAGLIEAYENDDSEAVTTHHEGALDALLEFEATTGD-SVASAAETAYFVARGFDSATVATLGDSERAATIPRAA 522
gi 445573566 448 RFEEEHLAGLVEDAAAGNADAAAAHAEGAMDALFEFEAAVGAtAEVSAAEAAFFGARGFDAAALAQVGASARAGSVVQST 527
gi 909658563 457 TFEEEHLKGLIKACENGDDAAVDEHATGIRETLLEFETTIGSpAQVSAVESGYMTARVFDAGVLDALGASGRAETVVGET 536
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  537 LAFFESGAAGYHEALEEANEDLYHRFEdEALGSVISAANDGGDVYAAAKTFYGAAIESVTAIVGSSGGGe-TGAGAASVV 615
gi 74568426  529 MAYFEGGAGGFHEAVEASNEETYHAFE-EALVGVSSTASDGGSVFDAATGFGAQSRTAVYDVIGNAGGD--LTAAAAAVA 605
gi 492948881 537 FTAFEKDTGGFHESLEHADHDLYESFE-SELSAVRSAANDGGDVFAAATAYETKAVDAIYAVVASGSGE--LSGVAAGIV 613
gi 909644678 537 FEYFENGAGGFHEALEDADHDRYESFE-GALGDAQAAAGNDESVGATARAFNEQAVAATYTVVAAAGGS--FGAAAASLM 613
gi 506244372 523 FEHFESGAAGYHEALEHADHETYETFE-SDLGAIRSTAESGGDVRSAVQTFVSTAIDGIYAIVGAAGGS--NGAAAAAIV 599
gi 445573566 528 FAFFESGAGGYHETLEEADHDLYESFE-GALGSVRTAAEEGGDAYGAAKTYGQKAVDSMYAVVATAAADagLGAAASERM 606
gi 909658563 537 FEYFENGAGGFHEALEDADHDRYESFE-GALGDAQAAAGNDESVGATARAFNEQAVAATYTVVAAAGGS--FGAAAASLM 613
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74552742  616 SDVFATFENAAVHDKLENADAEAYEAYEAALNDYVADLESGSt-------------DGASAFANAARTASFAVVGAVDSA 682
gi 74568426  606 RGALRDFEGARAHEPLEEADHDAYEAFESSFETYASGLESGT--------------GDVSVVRRASLRAQFAVAGDASAA 671
gi 492948881 614 QAAFQYFEGATVHELLEEADKGAYETFEAKIRDLKNALESGSev-----------tVALNAYADATTTAQFAVAGAIENA 682
gi 909644678 614 DAVYETFEGARVHELLEEADQEAYEGFEAALEEYIAALEASDae-----------sDAAretemdvdtaaeafataalqa 682
gi 506244372 600 QDVYATFEEARVHEALEEADHEAYEGFEAALEAYAGGLDGEGd-------------VPVGRLADATLRAQFAVAGALDDA 666
gi 445573566 607 TGVFQTFEEARVHEALEGADRDAYESFEAALSDYVDALADGSev-----------dAAAEAYATATARAQFAVVGEVGKA 675
gi 909658563 614 DAVYETFEGARVHELLEEADQEAYEGFEAALEEYIAALEASDaesdaaretemdvdTAAEAFATAALQAQFAVAGAADAA 693

                 .
gi 74552742  683 P 683
gi 74568426  672 P 672
gi 492948881 683 P 683
gi 909644678 683 q 683
gi 506244372 667 P 667
gi 445573566 676 P 676
gi 909658563 694 P 694
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap