Conserved Protein Domain Family
HIP1_clath_bdg

?
pfam16515: HIP1_clath_bdg 
Clathrin-binding domain of Huntingtin-interacting protein 1
HIP1_clath_bdg is the coiled-coil region of Huntington-interacting proteins 1. It carries a highly conserved HADLLRKN sequence motif at its N-terminus which effects the binding of HIP1R to clathrin light-chain EED regulatory site. this binding then stimulates clathrin lattice assembly. Huntingtin-interacting protein 1 (HIP1) is an obligate binding partner for Huntungtin, and loss of this interaction triggers the cascade of events that results in the apoptosis of neuronal cells and the onset of Hungtinton's disease. Clathrin light-chain binds to a flexible coiled-coil domain in HIP1 and induces a compact state that is refractory to actin binding.
Statistics
?
PSSM-Id: 318670
View PSSM: pfam16515
Aligned: 30 rows
Threshold Bit Score: 84.9885
Threshold Setting Gi: 542245953
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 736255451  468 HAELLRRSADTVKMLSATQQTQDEVERTKLQLAFEVDRIKQEADMKLE---EQKFEMEKLKRELDEKMAEMMRIKGTLQS 544
gi 183986635  462 HAGLLRKNADTAKQLTVSQQNQEEVARIKEELEFQMDQVKRESDLKLE---DQSFQTEQLKSEIEAKKKELLLIQQSLSS 538
gi 556954887  473 HAELLRKNADTAKQLTATQQVQEDVARTIETLQFEVDQGKRESEMKLE---EQTFLTEQLKQELEARKEELANVQLSLNS 549
gi 542245953  453 HADLMKKNTETVKILSSTKQEHDDLQRAKYQLETELESLRREKTNVMN---QQQMEVDRLNQELLEQRAELATLRSTLES 529
gi 765135898  453 HADLMKKNAEAVRMLSSSKQEQDDLLRTKMNLEKELENLRWDRQNKVQ---QQQQEVERLSKELQDQRAEVALLRSSLES 529
gi 768919782  451 HADLMKKNADTARLLSATKQEQDDLLRAKRQVENELENLRQEKRNMVN---QQQQEAQQLNQDLLQQKAEVTALRSSLEN 527
gi 874464347  435 HAELLRKNADTAKQLTVTQQSQEEVARVKEQLEFQVEQVKREAEMKLE---DQSVQMEQLRRELDARRDELDQAQSSLSH 511
gi 620959994  453 HAELLRKNADTAKQLSVTQQSQEEVARVKEQLAFQMEQVKRESDMKLE---DQSYQLDQLKRELEAKAGELARVQETLSH 529
gi 149063289  192 HAELLRKNADTAKQLTVTQQSQEEVARVKEQLAFQMEQVKRESEMKME---EQSDQLEKLKRELVAKAGELAHAQEALSR 268
gi 542245953  552 lrsareKDAELTTLRQQAQLQQSSLDLERDRTNRELEDLRAQLQRQLAinaEQKLEIDRLKRDLESTRAELAKANNILQN 631
                          90       100
                  ....*....|....*....|..
gi 736255451  545 SETTSEQMSSSMTALQAEKERL 566
gi 183986635  539 TEESKSQLNSTLMSLEVEKDTL 560
gi 556954887  550 SEQAGSQLKSRLQELQDENSTf 571
gi 542245953  530 KEKEGSQVSSSLTALQAEREVL 551
gi 765135898  530 KETEGSRVSGTLAALQAERDTL 551
gi 768919782  528 KEKEGSQVSSSLAALQAEREVL 549
gi 874464347  512 AKQAGSELSAQLETLQAEKEQL 533
gi 620959994  530 SEQSGSELNTRLDALRTEKDFL 551
gi 149063289  269 TEQSGSELSSRLDTLNAEKEAL 290
gi 542245953  632 KEMSGTQLNNTLAGLQVEKEGL 653
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap