3RWN,3RWN


Conserved Protein Domain Family
Phage_tail_NK

?
pfam16532: Phage_tail_NK 
Click on image for an interactive view with Cn3D
Sf6-type phage tail needle knob or tip of some Caudovirales
Phage_tail_NK is the globular tip protein of some tailed bacteriophages. Tailed bacteriophage virions deliver DNA to susceptible cells after adsorbing to specific receptors on the surface of the bacteria. In the Gram-negative bacteria these receptors are surface proteins or polysaccharides. In the phage Sf6-type needle, this distal tip folds into a knob with a TNF-like fold, similar to the fibre knobs of bacteriophage PRD1 and Adenovirus. It contains three bound L-glutamate molecules that are bind tightly in the crevices between the trimers of this trimeric tip.
Statistics
?
PSSM-Id: 318684
View PSSM: pfam16532
Aligned: 2 rows
Threshold Bit Score: 255.887
Threshold Setting Gi: 335892534
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                   10        20        30        40        50        60        70        80
           ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3RWN_B  10 SRIDALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSG 89
3RWN_B  10 SRIDALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPSG 89
                   90       100       110       120       130       140       150
           ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
3RWN_B  90 TANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGASFTATTIKIIAEQ 161
3RWN_B  90 TANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGASFTATTIKIIAEQ 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap