3VHX


Conserved Protein Domain Family
MKLP1_Arf_bdg

?
pfam16540: MKLP1_Arf_bdg 
Click on image for an interactive view with Cn3D
Arf6-interacting domain of mitotic kinesin-like protein 1
This family is a C-terminal region of mitotic kinesin-like proteins that is necessary for the interaction with the small GTPase Arf6. MKLP1 is a Flemming body-localising protein essential for cytokinesis, so its interaction with Arf6 shows how Arf6 is involved in cytokinesis. The Arf6-MKLP1 complex plays a crucial role in cytokinesis by connecting the microtubule bundle and membranes at the cleavage plane.
Statistics
?
PSSM-Id: 318691
View PSSM: pfam16540
Aligned: 28 rows
Threshold Bit Score: 129.721
Threshold Setting Gi: 313234628
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3VHX_B         13 PIRLR-HRRSRSA-GDRWVDHKPASNMQTE------TVMQPHVP--HAITVSVaNEKALAKCEKYMLTHQELASDGEIET 82
gi 47550971   711 PVRLR-HRRSRSAsNSVWIDHQPTETLNTE------TVLQPN-KskNAKRVSNpSMKDIRKTDNYMLTHQEEDSAGELET 782
gi 156359950  723 PIRAKqHRRSKSS--DCWIEHKPPCHLDTD------TILQPFMKnkKTVSRPDqKDFKTTNATNYCLVDQEEDSSGEIAT 794
gi 340371871  721 ytKGK-AQRKRSL-SENWLEHKPTDCVENN------DILQPRFKkkKTVTNPKpKHFKSQNVDKYVLKHQEQDPSGDVKT 792
gi 195996517  689 eVKKY-LRRSQPS--DIWLEHKPDENVDEGiifqidTLLQLNLRkkKTVETPKvNDFAKAQANHYVLEHQEEDSQGEIET 765
gi 313234628  240 SERLAhKRRSKSA--ERWLAHTPKETIDPG------TVLQPKVL--AKKNVLIpSICDLRTVDQYVLTHQELGNGNKVKT 309
gi 82223348   710 PVRPL-HRRSHSAgGERWVDHKPTTNVDLD------TVMQPNIP--NAIKVNApNEKALSKCDKYVLTHQEVASDGEIQT 780
gi 959079157  608 AAPLR-PRRSRSA-GERWVDHRPPSHVPTE------TLLQPRVP--RAITVDSpSERALARCDRYLLTHQELASDGEIQT 677
gi 941797631  878 PVRPR-HRRSRSAgVEKWVDHKPPSSLDLG------TVLQPVIP--NAIQVSApNEKALSKCDRYVLTHQEVASDGEIQT 948
gi 47225889   248 PVRPL-HRRFSSPgQKKWVDHKPPSNLDLG------TMMQPVIP--NAIEVSSpSEKALAKCDKYVLTHQELASDDEIHT 318
                          90       100       110
                  ....*....|....*....|....*....|...
3VHX_B         83 KLIKGDIYKTRGGGQSVQFTDIETLKQESPNGS 115
gi 47550971   783 KIYKADVIPTRGGGRAVQFTDVEKLRSEDPLSS 815
gi 156359950  795 KIIKGDVYKTAGGGHSIQFTAIETLKERlqgnm 827
gi 340371871  793 ELYKGDILFTRTGGASVKFTDIEKLDHVSPKPS 825
gi 195996517  766 QLIKGDVFETETGGHSVHFTDVEVLQKRKSIEi 798
gi 313234628  310 TLVKGEVFGTCTGGMQVRFTGKEKLTSDFPSEK 342
gi 82223348   781 KLIKGEVFKTRGGGQSVQFTDIETLKQETPVAA 813
gi 959079157  678 KLIKGDVFKTRGGGQAVQFTDIETLKQESPTGR 710
gi 941797631  949 KLIKGEVIKTRGGGQSVQFTDIETLKQELTTVS 981
gi 47225889   319 HLIKGEIIKTRGGGQAVQFTDIETLKQEl---- 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap