Conserved Protein Domain Family
GIT_CC

?
pfam16559: GIT_CC 
GIT coiled-coil Rho guanine nucleotide exchange factor
GIT-CC is the coiled-coil region of GIT (G protein-coupled receptor kinase-interacting) proteins. This coiled-coil region is the surface that associates with the equivalent binding-region on beta-PIX, or p21-activated kinase-interacting exchange factor proteins. Both GIT and PIX complex together to form a scaffold for the formation of multi-protein assemblies. On its own the GIT-CC region assembles into a parallel two-stranded CC in the asymmetric unit. Similarly the PIX coiled-coil region assembles into a trimer. At least in vitro the two regions associate together into a stable heteropentameric complex that consists of one PIX trimer and one GIT dimer.
Statistics
?
PSSM-Id: 318708
View PSSM: pfam16559
Aligned: 14 rows
Threshold Bit Score: 80.5076
Threshold Setting Gi: 260829090
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 393910849 442 KSDDSgDLlqETGPVMIDDFLELKEKVANAESTLTAVQQANTQILRMLTHLQSSVDRLNADNADVHDE 509
gi 918617686 414 KSLDS-DL--SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSSLRKQ 478
gi 390363801 156 tSAASsEL--SDGQVSMEEFLEVKKKLSTSDSRVEHLLNMNKQLNQEVHMLQSMVDKLKEENAKLlvl 221
gi 321473347 438 KGLQDlNQ--QKSGVSVEAYIGIKEQLSLSNVRMQELLASNTNMQTQIAQLQNMVQTLVQENNQLKTQ 503
gi 62858259  414 kSLEA-EL--SDGSVTVQEFLELKNALVASESKIQQLMKANNNLSDELRVMQKKLQTLQCENTNLRRQ 478
gi 734609477 414 kSLDS-DL--SDSPITMHEYLEVKNALSASEAKIQHLMKANNNLSDELRLMQKKLQSLQSENTSLRRq 478
gi 642131612 113 KSSESsDL--SDGPITVQEFMEVKSALTASEAKIQQLLKVNCHLSEEIRMMQSKLNSLQTENSTLQWQ 178
gi 156392717 412 KGTSTsFV--LEDTVPMENYLELKRALATAEARIQQLLQVNASMSQGIQELQSVQIPLAPNEDDDDDD 477
gi 260829090 415 ESMASsDL--SDGPITLEEYLQVKKALAASDARVQQLIQVKQQQQQEISLLQSMVQKLMQENANLRTQ 480
gi 768949879 413 KSLDS-DL--SDGPITMQEYVDLKNALTASEVKIQHLMKANNNLSDELRLMQKKLHTLQSENSSLRRQ 477
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap