Conserved Protein Domain Family
HECW_N

?
pfam16562: HECW_N 
N-terminal domain of E3 ubiquitin-protein ligase HECW1 and 2
HECW_N is a domain on E3 ubiquitin-protein ligases that lies upstream of the C2 domain; its function is not clearly understood, except perhaps to determine the substrate spectrum of the ligase.
Statistics
?
PSSM-Id: 318711
View PSSM: pfam16562
Aligned: 11 rows
Threshold Bit Score: 182.236
Threshold Setting Gi: 196001731
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 780144356   59 RSSSDSNLAHPDlqRRaghqSSLMVSKNEIILggdhGDSASANVTWDIREDVGSQDWIGLYLIGERNPASYLSYKNRGVS 138
gi 193786907   97 RSTSDTDLVTSD--SR----STLMVSSSYYSI----GHSQDLVIHWDIKEEVDAGDWIGMYLIDEVLSENFLDYKNRGVN 166
gi 196001731   10 STSDQANLVIDQ--EI----STLSISTNEVAI----G--SSIIISWDIKGPCLENDWIGLFYSDDDNTDNSIACFHRYKD 77
gi 260783562    1 RANSDTNLAHPDflNR----SSLSVSRYEYTF----GVDSSLVVTWDIKEEVGANDWIGLFPLSENSPNGFWDYKNRGVN 72
gi 762167389   40 RSNSESDLAAESpgLL----SYLAVDKNILNL----SKICSVKVSWDIKEEIGADDWIGLYQSGETDPSKFLDMKNRGGN 111
gi 795541041   45 RANSDTDLVTSE--SR----SSLTASMYEYTL----GQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVT 114
gi 966705990   50 RANSDTDLVSSQ--GR----SSLTASTLEFTL----GRGQNLVITWDIKEEVDATDWIGMYHIDETCPSNMWDCKNRGVN 119
gi 765168671   70 RANSDTDLLTSE--GR----SSLTASTYQLTL----GHGQ-LVISWDIKEEVDATDWIGLYHIDETCVANMWDSKNRGVN 138
gi 768953244   65 RSTSDTDLLSPD--TR----STLAISSSHYVI----GQSEDLVVTWDIKEEVDAGDWIGMYLLNELLSENFLDYKNRGIN 134
gi 765153688   65 RSTSDTDLVSPD--AR----STLTVSTSHYTI----GQSEDLVISWDIKEEVDAGDWIGMYQVDEVLSENFLDYKNRGIS 134
gi 688613242   53 RSTSDTDLLTLQ--SR----STLTVSSSQYCI----GQSEDICICWDIKEEVEPGDWIGMYLIDEVLSENFLDYKSRGVS 122
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 780144356  139 GTHKGQIIWVV-DAEPNFTKPLTKVCFKYYHGATGELRACTSTINIKNLDV 188
gi 193786907  167 GSHRGQIIWKI-DASSYFVEPETKICFKYYHGVSGALRATTPSVTVKNSAA 216
gi 196001731   78 VYRKGKYSWLVrEFDNEFGKATSQCCFRYYNSTSQILRAVSPVFTVYNPNV 128
gi 260783562   73 GTHKGQIIWVL-DPEPHFNESVTRICFKYYHGATGALRAITPSISVKNPQA 122
gi 762167389  112 GGQTGDLQWDLsDIMHNFTTDETKICFKYYLGSNQDLVATSPSVKVVKPAt 162
gi 795541041  115 GTQKGQIVWRI-EPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPAV 164
gi 966705990  120 GTQCGQIFWRL-EAGPYFLEAETRISFKYYHGVSGALRATTPCITVKNPRA 169
gi 765168671  139 GTQTGHIVWRL-EPEPYFTEPETKICFRYYHGLSGALRASTPCITVQNPGV 188
gi 768953244  135 GSHKGQILWKI-EPSSHFPDAETQVCFRYYHGASGALRATTPSVTVRNGCA 184
gi 765153688  135 GSHKGQIVWKI-DSSSNFRDVETQVCFRYYHGVTGALRATTPSVTIKKSAA 184
gi 688613242  123 GSHKGQIRWRI-DASLYFMEAETKICFKYYHGLSGALRATTPSVTVRNTSA 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap