Conserved Protein Domain Family
CEP209_CC5

?
pfam16574: CEP209_CC5 
Coiled-coil region of centrosome protein CE290
CEP290 and similar centrosomal proteins carry a number of coiled-coil regions, and this is the fifth along the length of the protein. It is thought that the proteins are involved in cilia biosynthesis.
Statistics
?
PSSM-Id: 318722
View PSSM: pfam16574
Aligned: 15 rows
Threshold Bit Score: 113.202
Threshold Setting Gi: 961439816
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119365083 1272 TMLHLQEDRARVREDAQIAEEERRKAEGKAQELELKLKGLEELIATLKDAKGAQK----VSEWHKKLEDVRLLEMRQSRE 1347
gi 972984164 1278 TMIQLQNDKLKILQDVQRTEQEKRKTEEKALELEIKMKGLEELISTLKDVKGAQK----VTEWHKKMEELRLQDLKRSRE 1353
gi 528521468 1272 TMLHLQEDRARVREDAQITEEERRKAEGKAQELELKLKGLEELIATLKDAKGAQK----VSEWHKKLEDVRLLEMRQSRE 1347
gi 156383829  184 TMRALHEDKANLERDLRKVTEDRLLAEDKLSELELKHRNLEELIATLKDGKGAAK----VTEWHTKMNEIRIQDLKLNRT 259
gi 780136470  638 AMIQLRLDKERMEKEMKVLKHEREKVSEQFADLELKHSGLQELMQTLKDSRGAAK----VAEWHAKMQETRLQDMKLNRQ 713
gi 405954230 1274 QMMQLQQDKQKLEIELKQAREHRDQEEDKLAELNLKNNSLQELIATLKDGRGAAK----VVEWHGKMDAVRLEELKQRRL 1349
gi 47220555   752 ALASLQEDRVKAQAEKKKVEEERRRAEGRAQELEVKHQGLQELLSTLRDGKGAQK----VLEWHKKMEETRIQELRKGRE 827
gi 313243447  579 QVSKIKEQKNELERHREALLREKGDLESARVEYEVKLAGLNELMAQIKTNSSREKeivhVQEWHQKIELAKMSEQKAKRA 658
gi 962024289  349 AMLKLQEDRAKAQEERRAAEVERRRADGRAQELEVRLRGLEELISTLKDVKGAHK----VMEWHKRMEEARLQELRKGRE 424
gi 908536225 1266 TMLSLQEDRAKAQKEKKRAEQESKRAEGRADELELRLQGLEELVSTLKDVKGAQK----VTEWHKKMEETRLQELRKGRE 1341
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 119365083 1348 LNTQREEIKYLKNCVAEQECTISGLEEELVQQNNLLEERQLIWDQREVQLER 1399
gi 972984164 1354 FGFQKEEIKYLKNVIAGQERTISSLEEEVIQQKNLHEEQQLSWDQREVELER 1405
gi 528521468 1348 LNTQREEIKYLKNCVAEQERTISGLEEELVQQNNLLEERQLIWDQREVQLER 1399
gi 156383829  260 IDRMKEQCRFLENLNKQHERTISDYEDDIVEMTKHHEERQLLWEQREVELER 311
gi 780136470  714 ITRLQQQVKYFDNMVTTHEQTVMSLEQENVHINRQAEERQLLWEQREAELER 765
gi 405954230 1350 NTKLQGQIKYLEGVIRTSEATIADLEAESVRVTKDCEEKQLRWEHREVELER 1401
gi 47220555   828 LIAQKEENQYLKNLVEEHERAICKLENEIVQQNMLefalskisvhvrtitnm 879
gi 313243447  659 ATEAKTLNKALKTQIDSHLCTIDELENDFLTRQNVHSNFAAMASRHEsvmie 710
gi 962024289  425 LVVQKEEISYLKKLVEEQDRTVRSLEEDIVQLNSLQEERQLAWDQREvelER 476
gi 908536225 1342 LVVQKEEIKYLRNLVKEQEQTIHSLEEDIVQLKTLHEECQLAWDQREvemER 1393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap