3JVF


Conserved Protein Domain Family
IL17R_fnIII_D2

?
pfam16578: IL17R_fnIII_D2 
Click on image for an interactive view with Cn3D
Interleukin 17 receptor D
IL17R_fnIII_D2 is the second extracellular fibronectin III-like domain on interleukin17-receptor-D molecules. The exact ligands of IL17R-D are not known.
Statistics
?
PSSM-Id: 318726
View PSSM: pfam16578
Aligned: 22 rows
Threshold Bit Score: 162.528
Threshold Setting Gi: 1020960039
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JVF_C        168 SGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFpHMENHsCFEHMHHIPA----PRPEEFHQRSNVTLTL-RNL 242
gi 612052565  196 SGSLWEPDILVERLKNNSLVVSFNLWNESTFYKILVNGFpNTETNsCYEEVQYINQ----SREEDFHHRTNVTFLL-QNV 270
gi 821487562   10 SGSLWEPDITGERLKNNSLLVSFNQGNESTSYNVLVNGFpETETSrCYEDFRIIDQ----P----IHDRVNVTFAL-QNM 80
gi 537138205 1866 SGSLWDPNITVETLDTQQLRVSFILWNESTPYQILLDSFpHSGDQnCFDDIQQIPA----PRQEEFHQRVNVTLPL-SKS 1940
gi 483511747  141 TGSLWEPRIQAKSLDDMTLLVSFNPWTESTRYQIHVTSF-LNEKK-CKMITREVTE-------GELPSQANVTIKMeKNL 211
gi 733870631   87 TGSLWEPKIQARSLDDITLLVSFNPWKEPTRYQIHVTSF-LNERK--------CKMitrdVTEDELQPQANVTIKMeKNL 157
gi 20454961   199 SGSLWDPNITVETLDTQHLRVDFTLWNESTPYQVLLESFsDSENHsCFDVVKQIFA----PRQEEFHQRANVTFTL-SKF 273
gi 296487043  183 SGSLWDPNITVETLEAHQLQLSFTPWNESTSYQVLLHSFpPAENQsCFQYVIDLPV----PAQEATQQRCHIMVTL-PDS 257
gi 472824639   88 SGSLWDPDITVETLEAHQLQLSFTPWNESTNYQILLSSFpHTENQsCFQYILDLPA----ASQEASQRCCNITIPL-LPS 162
gi 958742664  240 SGSLWDPNITVETLEAHRLRVDFTLWNESARYQILLSSFpHMENQsCFDDVQNILK----HTPEASHQRANITLTL-SDF 314
                          90       100       110
                  ....*....|....*....|....*....|
3JVF_C        243 KGCCRHQVQIQPFFSSCLNDCLRHSATVSC 272
gi 612052565  271 NACCQYSVQIQPFFKSCRNDCLRHTQSIPC 300
gi 821487562   81 NACCQYSVQIQPFFKSCQNDCLRHTLSIpc 110
gi 537138205 1941 SWCCHHHVQVQPFFNSCLNDCLRHAVTVRC 1970
gi 483511747  212 RACCKYEVQIQPFFANCGTDCLRHSTFIPC 241
gi 733870631  158 KACCNYKVQIQPFFAICGTDCLRHSTFIPC 187
gi 20454961   274 HWCCHHHVQVQPFFSSCLNDCLRHAVTVPC 303
gi 296487043  258 SWCCRHHVQIQPFFSSCLNDCLRHSLSVAC 287
gi 472824639  163 SWCCRHHVQIQPFSSSCLNDCLRHSVAVPC 192
gi 958742664  315 NWCCRHHVQIQPFFSSCLNDCLRHTVTVPC 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap