Conserved Protein Domain Family
ATP-synt_Z

?
pfam16594: ATP-synt_Z 
Putative AtpZ or ATP-synthase-associated
This is a family of short highly conserved plant proteins that might be associated with ATP-synthase atp operon.
Statistics
?
PSSM-Id: 318737
View PSSM: pfam16594
Aligned: 10 rows
Threshold Bit Score: 43.6057
Threshold Setting Gi: 944266696
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|.
gi 122170699   65 FHPAHEQLWMVPVGLVLLGTPLVAWLSLFAS 95
gi 944236741   40 FHPTYAHLWMVPLGLVLAGTPPVVCLALRCS 70
gi 734329665   51 YHPTNRQLWMVPFGLILLLTPVIVWLSLIIS 81
gi 734347377   48 YHPSNTQLWMVPFGFLLFLTPLIICLSVILP 78
gi 944059267   37 FHPSNSHLWMVPVGLVLACTPTVVFLALTFS 67
gi 731420734   69 YHPTNSQLWMVPFGLIMLVTPVIVCFSVFVS 99
gi 944266696   72 FRRANAMLWMVPAGLVLLGTSLLAWLSVLAS 102
gi 566158596   48 YHPTNSQLWMVPSGLILLVTPVIAWVAAVVS 78
gi 1000945291  49 YHLTSSQLWMVPLGLILLITPPVVWFALIVS 79
gi 224130648   47 YHPTNSQLWLVPFGLILFVTPVIACFAVVVS 77
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap