Conserved Protein Domain Family
dbPDZ_assoc

?
pfam16610: dbPDZ_assoc 
Unstructured region between two PDZ domains on Dlg5
dbPDZ_assoc is found on higher eukaryote Dlg5, Disks large homolog 5, proteins, lying between the second pair of PDZ domains. The sequence is natively unstructured but may just be long extensions of the PDZs on these sequences in this position. The function is not known.
Statistics
?
PSSM-Id: 318751
View PSSM: pfam16610
Aligned: 10 rows
Threshold Bit Score: 116.548
Threshold Setting Gi: 953841165
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 908481530  1486 YNPHMFQLGNHSRSGSRMESISNQPSPHDSGATTPDNHSTVELLSEQDEGTITPASKQTTPATSPHISCRLPGSNPRRVP 1565
gi 992186441  1361 YNPHMYQLGNHSRSSSRLEPVSTQPTPQGSGATTPDNHSTIDTLSEQDEGTLTPSSKQTTPTTTPHSFIRMPSEGSKKVP 1440
gi 542192436  1507 YNPHMFQLGNHSRSGSRMESISNQPSPHDSGATTPDNHSTVELLSEQDEGTITPASKQTTPATSPHISCRLPGSNPRRVP 1586
gi 941757231  1495 YNPHMFQLGNHSRSGSQMESSNNHLT------TSPDNHSAVDTLSEQDEGTMTPPSRQTTPATSPHNSFRLPGSLLLRAA 1568
gi 512853246  1472 YNPNMCQ-HIHSRSSSRLDTSTTHSTPHSSGAATPDNHSIIDTVSEQDEGTMTPPSKESTPSTSPCSSLRTNAEGIKRHS 1550
gi 992225889  1354 YNPHMYQPGNHSRSSSRMESVSSCSTPVGSGAGTPDARSTIDTLSEQDEGTMTPPSKNTTPATSPGSSVRGWSEGGRHVe 1433
gi 1022964169 1342 YNPHMYQLGNHSRSSSRLDPVSTHSNPQGSGTATPDSHSIIDTVSEQDEGTITPTSKQTTPTTSPRNSIRVLADSNKRPP 1421
gi 1033365447 1546 YNPHMFQLGNHSRSSSRLEPVSSHSTPQGSGAATPDSHSIIDTVSEQDEGTMTPPSKQTTPTTTPPNSMRNSMDATKKTP 1625
gi 953841165  1525 YNPHMHQLSSHSRSSSHLDPANIHSTLQGSGATTPEHPSVIDPLMEQDEGPGTPLAKQSTPSS------RMVGDANKKTP 1598
gi 1042351029 1445 YNPHMYQLGNHSRSSSRMEPVSSQSTPQGSGATTPDNHSTIDTLSEQDEGTLTPSSKQTTPTTSPHSFIRMSSEGSKKIP 1524

                   .
gi 908481530  1566 E 1566
gi 992186441  1441 E 1441
gi 542192436  1587 E 1587
gi 941757231  1569 E 1569
gi 512853246  1551 E 1551
gi 992225889  1434 p 1434
gi 1022964169 1422 E 1422
gi 1033365447 1626 E 1626
gi 953841165  1599 E 1599
gi 1042351029 1525 E 1525
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap